KEGG   Petrotoga mobilis: Pmob_1121Help
Entry
Pmob_1121         CDS       T00621                                 

Definition
(GenBank) peptidase M42 family protein
Organism
pmo  Petrotoga mobilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1202869..1203873
Genome map
AA seq 334 aa AA seqDB search
MKELIKNITELYGPSGREDQVRDFIKEQIKDHVDDIKTDKLGNLIATKKGNSGKTILFDA
HMDEIGVVVTHILDKGFLKVEQVGGQNPVNLIGSRLIFNGRIGVVGVEGESEKELKDNYK
NLSLDNIFVDIGVSSKEEAEKIAPIGTFGTFAEGFVDYGNYCMSKAMDDRIGCAILIETI
KNMKDNQHTVLFAFTIQEEVGLVGSFVSAYDYEVDRAIAIDVTDSLDTPKALKRMSMALG
KGPCIKIKDNLSVSDREVVEWIKNAALANNIPYQFEVLTFGGTNAAGYQRTKSGIPSGTI
SIPTRYIHSPHEMLSYSDVENTVKLLNTLSKTNF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagctaataaaaaatattacggaactttatggaccaagtggaagagaagatcaa
gtgagagattttataaaagaacagatcaaagatcatgtggatgatattaaaacagacaag
ttaggaaatcttatcgccacaaaaaaaggcaactctggaaaaaccatattatttgacgct
cacatggatgaaataggggttgttgttacacacattttagacaaaggctttttaaaagta
gaacaagtcggcggtcaaaaccctgtaaatttgatcggttccaggttgatttttaatgga
agaataggggttgttggagttgagggagaaagtgaaaaagaattaaaagataattataaa
aacttatctttagacaatatatttgttgacataggcgtatcttcaaaagaagaagcggaa
aaaattgcccctattggcacttttggaacctttgcggaaggtttcgtcgattatggtaat
tattgtatgtcaaaagccatggatgacagaattggatgcgccattttaatagaaaccatc
aaaaatatgaaagataatcaacacacagttttatttgcttttactatccaagaagaagta
ggtttagtcggatcttttgtttcggcttatgattacgaagtcgacagagcaatagctata
gatgtcacggattccttggatactcctaaggctcttaaaagaatgagcatggctttggga
aaaggaccttgtattaaaataaaagacaatctttctgtaagtgacagagaagttgtagaa
tggataaaaaatgctgctttggcaaacaacataccctatcagttcgaggtattaaccttc
ggaggaacaaatgccgcgggctatcaaagaactaaatctggaattcctagtggtactatt
tctattcctactagatacatacattcacctcacgagatgttatcctatagcgatgttgaa
aacacggtgaaactattgaatacgcttagtaaaacgaatttttag

DBGET integrated database retrieval system