KEGG   Petrotoga mobilis: Pmob_1152Help
Entry
Pmob_1152         CDS       T00621                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmo  Petrotoga mobilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmob_1152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1152
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pmob_1152
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pmob_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1233838..1234902)
Genome map
AA seq 354 aa AA seqDB search
MRNFSFWPGIINAYKEYMPVDEKTEIITLQEGNTPLIFAEKMSNMWDIELYLKYDGANPT
GSFKDRGMCLAVTKALQNGDKAIICASTGNTSASAAAYGSRAGLKTAVIIPEGKIALGKL
SQALMHGAIVIPIKGNFDVALEITRKIADNYPITLVNSLNPYRIEGQKSAAFEVCDQLGG
KSPDILAIPVGNAGNITAYWKGFKEYFKDHKTDKLPKMIGFEAEGSAAIVKNQVIKNPET
VATAIRIGNPVNWEKAVEAAKESGGFINFVTDEEILDTYKELASLEGVFAEPASAASVAG
VKKMIKLDKIKKGSKIVAVLTGHGLKDPDTAISVIPKVNPVEPEMETILKLIGL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaattttagtttttggccgggtataataaatgcttataaagaatacatgcccgtc
gatgagaaaacagagataattacgttgcaagaagggaacactcctttgatattcgcagaa
aaaatgagtaatatgtgggatattgagctttatctgaaatatgatggtgctaatcccacg
ggatcttttaaagacaggggaatgtgtttagccgtaaccaaagccctgcagaacggtgat
aaagcaataatctgtgcttctaccggtaacacttctgcctctgctgcggcttatggaagt
agagcaggattgaaaacagcggtcataatccctgaagggaagatcgccttggggaaatta
tctcaggccttaatgcatggggctatagttataccgataaaaggtaattttgacgttgcc
ttagagattacaagaaagatcgctgacaactatcctataactctggttaactcacttaat
ccatacaggatagaaggtcaaaaaagtgctgcttttgaggtatgtgatcaattaggtggt
aaatctcctgacatattggcaattccagtggggaatgcgggaaacatcacagcttactgg
aaagggttcaaagaatacttcaaagatcacaaaacggataagttacctaagatgattggt
tttgaagcggaaggatcagctgctatcgtaaaaaatcaggttataaaaaacccagaaacc
gtagcaacagctataagaataggtaatccggtcaattgggaaaaggccgtagaagctgca
aaagaatctggaggatttataaattttgttaccgacgaggaaatcttggacacgtataaa
gaattggcatccctcgaaggtgtgtttgcagaacctgcttctgcagcttcggtagcgggc
gttaaaaaaatgatcaaattggataagataaaaaaaggaagtaaaattgttgcggtactc
acgggacatggattaaaggatcccgataccgcgataagtgtgataccaaaggtcaatcca
gtagaaccagaaatggaaactatattgaaattgatagggctgtaa

DBGET integrated database retrieval system