KEGG   Petrotoga mobilis: Pmob_1182Help
Entry
Pmob_1182         CDS       T00621                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00052  Galactose metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
Module
pmo_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1182
   00052 Galactose metabolism
    Pmob_1182
Enzymes [BR:pmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Pmob_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABX31900
JGI: Pmob1182
UniProt: A9BHM8
Position
complement(1268043..1269113)
Genome map
AA seq 356 aa AA seqDB search
MSILEHIEKNQWGYTTEGIPVTLFTLRNENGITVQVTNYGATLVSLYLPDKKGEMEDIIL
GFDTVSDYEKPTPQNPFFGATIGRHANRIKNGQFSLEGKNYTLAQNNNSNHLHGGLKGFQ
KQIFQATAFTTVEGPSVRFKRLSHDGEEGYPGNLRVSVTYTLTNDNELKISYTATTDKTT
IINLTNHSYFNLAGEGRGNIFDHQLELFANHYTPVEETLIPTGEIKSVKNTPFDFTVPKI
LGEVLKDLKDSPLEGIDHNFVLNKENSKISLAVRLVEPTSGRVMKIYTTEPGIQVYTGNF
VDTYGKEGKHYGKYSGIALETQHFPNSPNQKNFPSTILRPSEVYSSTTIYKFSIVN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaattttagaacatattgaaaaaaatcaatggggatatacaacagaaggcattcca
gtaactttgttcacattaagaaacgagaatggaatcacggtacaagtaacaaactacggt
gctactttggtttctttgtacttacctgacaaaaagggagaaatggaagacataatttta
ggattcgatactgtttcagattatgaaaaacccactccacagaatccctttttcggtgct
acaatagggcgacatgcaaacagaataaaaaacgggcaattctcacttgaaggtaaaaat
tacaccttggctcaaaataataattcaaaccatcttcatgggggattaaaggggtttcaa
aaacagatatttcaagcgacagcttttacaactgtcgaaggaccttctgttcggttcaaa
cgtttaagccacgatggtgaagaaggttatccaggaaacttacgtgtaagcgttacttac
acattaaccaacgataatgaattaaagatttcttataccgcaactactgataaaactact
attataaatttgacaaatcacagttattttaatttagcaggtgaaggtagaggaaatatt
tttgatcaccagttggaactttttgctaatcattatacacctgtagaagaaacgttaatc
cccaccggagaaataaaaagtgtcaaaaacacaccctttgattttacagtcccaaaaatt
ctcggtgaggtgctcaaagatctgaaagattctccgttagaaggaatagatcataatttc
gtattaaacaaagaaaatagcaaaatatccttagctgtaaggttggttgaacccacaagt
ggaagagtgatgaagatatacacaaccgagcctgggattcaagtatatacaggtaatttt
gttgacacatacggaaaagaaggaaaacactacggaaaatattctggaatagctttggaa
acacagcattttccaaactctccaaatcagaaaaactttccttccacaattttaaggccc
tcagaagtgtactcttctacaacaatttacaaattttctatcgtgaattag

DBGET integrated database retrieval system