KEGG   Petrotoga mobilis: Pmob_1207Help
Entry
Pmob_1207         CDS       T00621                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmo  Petrotoga mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmob_1207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmob_1207
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmob_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1290330..1291106)
Genome map
AA seq 258 aa AA seqDB search
MSKISEVFKNSKALITYVTAGDPNLEVTKEIILELNKDGVDIIEVGIPFSDPLADGPIIQ
KASQKALKNGVTLKKIFETLNEIKEEVTCPLVLMGYYNSILNYGIDNFITEAVNTGISGV
IIPDLPFDEEEEFYAKIKENGIDPILLVAPNTSEERLKEISKVCSGFLYCVSIMGVTGDS
QAPMEHLKEYSQRVRKYVNIPLAIGFGIDSPTKAKNIIEYFDGIIVGSALIKIIDENSDD
KGKLLKEIKRFTKSLKVW
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaataagtgaagttttcaaaaatagcaaggctttaatcacctatgtaacagcc
ggagatccgaacttagaggttacaaaagaaattatattagaattgaacaaagatggtgtt
gatattatagaggtaggaatacctttttccgatcctttagcagatggaccaataattcaa
aaagcaagccaaaaagctttaaaaaatggggttacccttaaaaaaatttttgaaaccttg
aatgaaatcaaagaagaggttacttgcccactcgttttaatgggttattacaactcaatt
ctcaattatggtatcgacaattttataacagaagccgtgaatacaggcatctctggagta
ataattcctgatttgccttttgacgaagaagaggaattttacgcaaaaataaaagaaaac
ggtatcgatcctattttactagttgctccaaatacctctgaagagcgactaaaagaaatc
tctaaggtatgttctggatttttgtattgtgtatctattatgggagtaacaggggatagt
caagcacctatggagcatttgaaagagtattcacaaagagtgagaaagtatgttaatata
cctttagctatcggttttggaatagatagcccgacaaaggctaaaaatattattgaatac
ttcgatggaataattgtgggaagtgccctaataaaaataatcgatgaaaacagtgatgac
aaaggtaagttgcttaaagaaataaaaagatttactaaaagtttgaaagtatggtga

DBGET integrated database retrieval system