KEGG   Petrotoga mobilis: Pmob_1217Help
Entry
Pmob_1217         CDS       T00621                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00052  Galactose metabolism
pmo00500  Starch and sucrose metabolism
pmo00520  Amino sugar and nucleotide sugar metabolism
pmo00521  Streptomycin biosynthesis
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
Module
pmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1217
   00052 Galactose metabolism
    Pmob_1217
   00500 Starch and sucrose metabolism
    Pmob_1217
   00520 Amino sugar and nucleotide sugar metabolism
    Pmob_1217
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmob_1217
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pmob_1217
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pmob_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABX31933
JGI: Pmob1217
UniProt: A9BHR1
Position
complement(1300985..1301935)
Genome map
AA seq 316 aa AA seqDB search
MLVVGIDLGGTEIKAGLVDEKKGIIKKISRPTEVEMGNAQVIANITKTVKDLTENTEFSA
IGIGSPGSIDRKNGIVRFSPNFPNWRNFELVRLIKENINVDVFLENDANAFALGEWYFGK
AKGLHDFIALTIGTGIGSGVVCNNTFLTGKDGLAPELGHVVVVPNGPQCGCGNRGCVEAT
SSAKYIALEAKNLIDRYPDSLVLKLAGKKEKIESKHVFQAYEKNDPLARVVCNFAIDALA
RAIGGYVHAFNPEKIIIGGGLSRAGDALFVPLREMTKKYVMSSFADTYTIEQSSLVEDAG
ILGAASAAFYAEENPL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttggtagtaggaatcgatttgggaggcactgagataaaagccggattagtcgatgaa
aaaaaaggaataattaaaaagatttctagacctacagaagttgaaatgggaaatgcccaa
gtaatagctaatataacaaaaaccgtgaaagatttaacggaaaacactgaattttcagca
attggaataggttcaccaggttctatagatagaaaaaatggaattgtgagattttctcca
aactttccaaactggcgaaattttgaattggttcgcttgataaaagaaaatataaacgtt
gacgtctttttagaaaacgatgccaatgcctttgcacttggtgaatggtattttggtaaa
gcaaagggtttgcacgatttcatcgctttaaccataggaacaggcataggttccggagtg
gtttgtaacaacacatttttaaccggtaaagacggtctagccccagaattgggacatgtt
gtagttgtaccaaatggtccacaatgcggttgcggtaataggggatgtgtagaagctact
tcttctgcgaaatatatagcattagaagccaaaaatttgatagataggtacccagacagc
cttgttttaaaattagccggaaaaaaagaaaagattgaatcaaagcacgtttttcaagct
tatgaaaaaaatgatcctcttgccagagtagtttgtaactttgccatcgatgcacttgca
cgggctattggaggatatgttcatgcctttaacccagaaaaaattataatcggtgggggg
ttaagcagagcaggtgatgctctttttgttccattaagagaaatgacgaaaaaatatgta
atgagcagtttcgcagatacttacactatagaacaatcatctttagtagaagatgctgga
attttaggggcagcttctgcagccttttatgccgaagaaaaccccctataa

DBGET integrated database retrieval system