KEGG   Petrotoga mobilis: Pmob_1316Help
Entry
Pmob_1316         CDS       T00621                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmo  Petrotoga mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmob_1316
Enzymes [BR:pmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pmob_1316
Exosome [BR:pmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmob_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1405056..1407242)
Genome map
AA seq 728 aa AA seqDB search
MPILTEKEINMLVNAECHDPFIYLGLRELDKENLVIRVLQPFAKEAYLISKNTTIKLDKI
HKTGLFEKKIPGSQIFEYEIKCTDYNANTWTYKDPYSFLPVISEYDRYLFNEGNHYKIYE
KLGAHPMKINGIEGVLFSTWAPNAKRVSVVGNFNNWDGRIHQMRVLGQSGIWEIFVPGVV
EGDLYKFEIKTQNGDILLKTDPYGTYFEVRPKTAAIVYDKQNKHTWNDSKWMEERKNKNW
IKEPMSIYEVHLGSWARKEENQFLNYRELAEKLSAYLKENHFTHIELLPVSEHPLDISWG
YQVTGYYAPTSRFGKPEDFMYFVDKMHQEGIGVIVDWVPGHFPKDAHALGRFDGTALYEH
LDSRLGEHKDWGTYIFNYGRTEVKNFLLANALFWLDKYHIDGLRVDAVASMLYLDYSRQD
GEWIPNKYGGRENLEAIDFIKQLNTVAYQYFPGIVTVAEESTAFPGVTTPVHEGGLGFEF
KWNMGWMNDTLRYFSKDPIFRRYHQNDLTFSLVYAFSENFILSISHDEVVHGKRSLLEKM
PGDDWQKFANLRLFYSYMYAHPGKNLLFMGSEIAQRKEWDCSNSLDWHLLQYEPHKKTQL
FLKDLNILYKNHPALFEIDHRYEGFEWIDFNDADNSVISFIRKSENEDEIIVCVFNFTPV
PRDNYRIGVPKKGVYQEILNTDWTQYYGSGVDNPKEVYSQDIPMHGREQSIILTLPPLGG
LYFKFLIK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgccaatactaacggaaaaagaaataaatatgcttgttaatgccgaatgtcacgacccc
tttatctatctaggcttaagagaactcgataaagaaaacttagtcataagggttctacaa
ccctttgcaaaagaagcatatttgatttctaaaaacaccactataaaactcgataaaatc
cacaaaactggactctttgaaaaaaagattccaggttcacaaatatttgaatacgaaata
aaatgcacagactacaacgccaacacctggacttacaaagacccctactcttttttacca
gtcatatctgaatacgacagatatctcttcaatgaagggaaccattacaaaatatacgaa
aaactaggcgcgcaccccatgaaaataaacggaatcgaaggggttttattctcaacgtgg
gcaccaaacgctaaaagagtcagcgtggttggaaatttcaacaattgggatggaagaatt
catcaaatgagggtcttaggtcaatcaggaatatgggaaatcttcgttcccggtgttgtt
gaaggagacttatacaaatttgaaatcaaaactcaaaatggagacatcttgctaaaaaca
gacccttacggaacttactttgaagtaaggcccaaaacagccgccattgtatacgacaaa
caaaacaaacacacgtggaacgactccaaatggatggaggaaagaaaaaataaaaattgg
ataaaagaaccgatgtctatctatgaagtccatctaggctcctgggcaagaaaagaagaa
aatcaatttctaaattatagggaactagcggaaaaactttcagcataccttaaagaaaac
cattttactcacatagaactattaccggtaagcgaacaccccttagacatctcttgggga
taccaggtaacaggttactatgctccaacaagcaggtttggaaaaccggaagatttcatg
tactttgtagataaaatgcatcaagaaggtataggcgtcatcgttgattgggtgcctgga
cacttcccaaaagacgcacatgctttgggaagattcgatggcacagccctttacgaacac
ctcgacagcagattgggagaacacaaagactggggaacttacatattcaattacggaaga
accgaagttaaaaactttctattggcaaacgcactattttggttggataaataccacatc
gacggcttaagggtagacgctgtagcttcaatgctatacttagactacagcagacaagat
ggagaatggattcccaacaaatacggtgggcgagaaaatctcgaagccattgatttcatc
aaacaactcaacaccgtcgcctatcaatacttccctgggattgtaaccgttgcagaagaa
tctacggcgtttccaggagtaactacgccggtacacgagggcggtttaggctttgaattc
aaatggaatatgggttggatgaacgacacattaagatactttagcaaagacccaatattt
agaagataccatcaaaacgacctcacattttccctagtatacgctttttccgaaaacttt
atcttatccatttctcatgacgaagtcgtacatggcaaaaggtcccttttggaaaaaatg
ccaggtgatgattggcaaaaattcgccaacttaaggctcttttactcctacatgtatgcc
catcctggcaaaaatttactctttatgggaagtgaaatagcccaaagaaaagaatgggac
tgctctaacagtttagactggcacctattacaatacgaacctcacaaaaaaacacaacta
tttttaaaagacttaaatatactgtacaaaaatcatcccgcattatttgaaattgatcac
cgttatgaaggcttcgaatggatagacttcaacgatgcggacaacagtgtaatatctttt
ataagaaaatcagaaaatgaagatgaaattatcgtctgcgtcttcaatttcacaccagtg
ccaagggataactatagaataggcgtaccaaaaaaaggcgtataccaagaaatactcaac
acagactggacacaatactacggaagtggagtcgacaatccaaaagaagtatactctcaa
gacatacccatgcatggaagagaacaatccataatactcacactaccacctctaggtggt
ctatatttcaaattcctaataaaataa

DBGET integrated database retrieval system