KEGG   Petrotoga mobilis: Pmob_1444Help
Entry
Pmob_1444         CDS       T00621                                 

Definition
bifunctional phosphoglycerate kinase/triosephosphate isomerase (EC:2.7.2.3 5.3.1.1)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmo  Petrotoga mobilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmob_1444
   01230 Biosynthesis of amino acids
    Pmob_1444
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1444
   00051 Fructose and mannose metabolism
    Pmob_1444
   00562 Inositol phosphate metabolism
    Pmob_1444
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Pmob_1444
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pmob_1444
Exosome [BR:pmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Pmob_1444
  Exosomal proteins of colorectal cancer cells
   Pmob_1444
  Exosomal proteins of bladder cancer cells
   Pmob_1444
  Exosomal proteins of melanoma cells
   Pmob_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1555532..1557499)
Genome map
AA seq 655 aa AA seqDB search
MEKLTIKDVDLKGKKVIMRVDFNVPIKDGKITDETRIVAALDTIQYALDKGAKVILLSHL
GRPKGEKDPQFSLKPVADRLGELLNNKVYFVDETRGPKVEEAVSELKEGEVLVLENTRFE
KGETKNDPELAKYWASLADLHVNDAFGTAHRAHASNVGIADYIPSVAGFLMEKEIEFLQK
AVENPEKPYVVILGGAKVSDKIGVINNLLNKADKILIGGAMMFTFLKALDKKVGSSLVEE
DKLDVAKEILENAKAKGVEIVLPIDAVIAQKIEAGVEKKTVKIDDGIPEGWMGLDIGLET
VSLFKEKISDSKTIVWNGPMGVFEIDDFAFGTEEVAKAIAEVTKKGCISIIGGGDSAAAA
EKFGLASEFSHVSTGGGASLEFLEGIELPGISSISEKKNLNERIFILAGNWKMNKTNAEA
AEFVSKLIGQIKTQDKFEVIVCPPFTALEKVRDITSTSSIKVGAQNVYYEDKGAYTGEIS
VNMLKDIGVEYVILGHSERRHIFQESDELINKKLKKVLASGLKPILCVGEQLEEREKGLT
FNVVERQIKEALYGLTEEESKKIIIAYEPVWAIGTGKVATPNQAQEVHKFIRDLLKDIFN
EEFAKKTTILYGGSIKPNNYLGLFGKPDIDGGLVGGASLTQEFVELANIMKSIIE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattaactataaaagacgtagatcttaaaggcaaaaaagtcataatgagagtt
gatttcaacgttcctataaaagatggaaaaataaccgatgaaacaagaatcgtagccgct
cttgacacaattcaatacgccttagacaaaggagcaaaagtaatattactatctcactta
ggccgtcccaaaggtgaaaaggaccctcaattttctctaaaacccgtagccgatagatta
ggtgagctattaaataataaagtttattttgtagatgaaaccagaggaccaaaagttgaa
gaagctgtttcagagttaaaagaaggtgaagtattagttcttgaaaatacaagatttgaa
aaaggtgaaacaaaaaacgatcctgaactggcaaaatattgggcttctttagctgatctt
catgttaatgatgcttttggaacggctcatagagcacacgcttcaaatgttggaatcgcg
gactatataccaagtgttgcaggatttttgatggaaaaagagatcgaatttttacaaaag
gccgttgaaaaccctgaaaaaccgtatgtagtaatcctgggtggtgctaaagtatccgac
aaaataggggtaataaataatttgttaaataaagccgataagattttaatcggcggagca
atgatgtttacttttttaaaagctttagataaaaaggttggttcttcattagtagaggaa
gataaactcgatgttgcaaaagaaattctagaaaatgctaaagcaaaaggcgttgagatt
gttttacctattgatgccgttatcgctcaaaaaatagaagcaggtgttgaaaagaaaacc
gtaaaaatagatgatggaattcccgaaggttggatgggcttagatataggacttgaaacc
gtatctttatttaaagagaaaatttctgattccaaaacgatcgtttggaacggtcctatg
ggagtttttgaaatagatgattttgcttttggtaccgaagaagtagcaaaggcaattgca
gaagtaactaaaaaaggttgcataagtattataggtggaggagattctgcggctgcggca
gaaaaattcggtttggctagcgaattttcacacgtttcaactggtggaggagcctcttta
gagtttttagaaggtatagaattgccaggtatctcttcaatatccgaaaaaaaaaatctg
aatgaaagaatattcattcttgctggaaattggaagatgaacaagacaaacgcggaagca
gctgaatttgtctcaaaactaataggacagataaaaactcaagataagtttgaagttatt
gtttgcccgcctttcacagctcttgaaaaggtaagggatatcacaagtacttctagtata
aaagtaggtgcccaaaatgtttattacgaggataaaggtgcttacacaggcgagatctca
gttaatatgttgaaagatataggagtagaatatgtaattcttggtcattccgagagaagg
cacatctttcaagaaagcgatgaactcataaacaagaagctcaaaaaggtattagcatca
ggtttaaaacccatactgtgtgtaggtgaacagctggaagagcgtgaaaagggtttaacg
ttcaacgttgtagaaagacagattaaagaagctctttatggtttaacagaagaagaatca
aaaaagatcataatcgcctacgaacccgtatgggcaatcggaacaggcaaagtagcaaca
cccaaccaagctcaagaagttcataagtttatcagagaccttttgaaagatatcttcaat
gaagaattcgctaaaaaaactacaatactttatggtggaagcataaaaccaaacaattat
ttgggcctttttggtaaaccagatatagacggcggtttagttggaggtgcctcattaaca
caagaatttgtagagcttgccaatattatgaaatcaatcatcgaataa

DBGET integrated database retrieval system