KEGG   Petrotoga mobilis: Pmob_1448Help
Entry
Pmob_1448         CDS       T00621                                 

Definition
ATPase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pmo  Petrotoga mobilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmob_1448
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pmob_1448
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pmob_1448
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Pmob_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1560263..1561345)
Genome map
AA seq 360 aa AA seqDB search
MKPSTVKYLSKKIMASGEIPLLWGHFGVGKTDIAKEIAQETGRELIILIISQMEPGDLIG
LPSRDAEKTVFLKPDWWPNKDEVIIMIDEINRAHRSIRNAIMQLLIDRRIHNHILPAGAW
IMGAANPPDEEYDQVDLITDPAFMSRFFHLELSPDVDDWVNWSNQEQVKGEVISFIKEYP
EYLSSDNIVSMRLNLRPSPRSWYKLSNVLSNLSEDDMKKYGYVIAASIVGSEAARSFLSH
LENKVELPNPKDLLIEGKNLERIEKLTNEEKVSLILRINNYFESLNEEEMEQLLSDGDQK
TIAENVKIISEVIPKDAMFSVLRFLNEMVEKNKGLKKAFYDKLLEEIAIKLGDSTWMEGI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccatcaacggtaaaatacctatcaaaaaaaataatggcttctggagaaatacct
ctcttatgggggcattttggtgtcggtaaaacggatatagctaaagaaatagctcaagag
actggaagagaattgatcatattgatcatctctcagatggaacccggagatctaattgga
ctcccttctagggacgcagaaaaaacggtctttttaaaacctgactggtggcctaataaa
gatgaagtaataataatgatcgatgaaataaacagggcacacagatcgataagaaatgct
atcatgcaattattaatagacagaagaatacataatcacatattacccgctggagcatgg
atcatgggagccgccaatcctcccgatgaagagtacgatcaagtagatttgataaccgat
cctgccttcatgtcgagattttttcatttagaattgtctcctgatgttgacgattgggta
aactggtctaatcaagagcaagtaaaaggtgaagttatttcttttatcaaagaatatcct
gaatatctttcttccgataatattgtatcgatgagactcaatttaagacccagtcccaga
agttggtataaattatccaacgttttatctaatttatctgaagatgatatgaaaaaatat
ggttacgtcattgctgcctcaatagttggatccgaagcagctagatcgtttttatctcat
ttggaaaataaagttgaactaccaaacccaaaagatttactaatcgagggcaaaaatctt
gaaagaatcgagaaattgaccaatgaagaaaaagtaagtcttattttgagaataaataat
tattttgaatcattaaatgaagaagaaatggaacaattattatctgatggcgatcaaaaa
acaatcgcagaaaatgtaaagatcataagtgaggtcatacctaaggatgctatgttctcc
gtattaagatttctaaacgaaatggtagaaaaaaataaaggattaaaaaaagccttttac
gacaaacttttggaagaaattgccattaaactaggagattccacttggatggaaggaatt
tag

DBGET integrated database retrieval system