KEGG   Petrotoga mobilis: Pmob_1455Help
Entry
Pmob_1455         CDS       T00621                                 

Definition
helix-hairpin-helix DNA-binding motif-containing protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmo  Petrotoga mobilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pmob_1455
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pmob_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1568296..1568868)
Genome map
AA seq 190 aa AA seqDB search
MIRKINATIEDFEDEKVLIKIGVLTLEAYPSLNVIRYFKKGDQYEFFASLEISEWNTSLY
IFKDKIERDVFESLKKVSKIGPRIASKILRKTDAEEFIQMINSQDTALLSSLPGIGKKTA
ERLISELSNSFSAYSTGADTQSYGNNNLKEAIEALETLGFQRYEIMKVIGQLDLEDLKTE
EIIKECLTRL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaaaattaacgcaacaattgaagattttgaggacgaaaaagttctaatcaaa
attggagttttaactttggaagcttatccttcgttgaacgttataagatactttaaaaaa
ggtgatcaatacgaattcttcgcttccctagaaataagcgaatggaacacatcactttat
atttttaaagataaaatagaaagagatgtttttgaaagtttaaagaaagtttcaaaaatt
ggaccaagaattgcatcaaaaatccttagaaaaacggatgcagaagaatttatacagatg
ataaactcacaggacactgctcttctttcaagcttacctggcataggtaagaaaacagca
gaaagactaatatctgaactttccaactctttcagtgcctattcaactggggcagatact
caatcgtatggaaataataatctaaaagaagctatagaggccttagaaacactcggattt
caaagatatgaaattatgaaagtcataggtcaacttgatttagaagatctgaaaacagaa
gagatcattaaagaatgtcttacaaggctgtag

DBGET integrated database retrieval system