KEGG   Petrotoga mobilis: Pmob_1538Help
Entry
Pmob_1538         CDS       T00621                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pmo  Petrotoga mobilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmob_1538
   01230 Biosynthesis of amino acids
    Pmob_1538
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1538
   00030 Pentose phosphate pathway
    Pmob_1538
   00051 Fructose and mannose metabolism
    Pmob_1538
  Energy metabolism
   00680 Methane metabolism
    Pmob_1538
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pmob_1538
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pmob_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1668930..1670045
Genome map
AA seq 371 aa AA seqDB search
MEKVSVSLIKADVGGIPGHSTVHPKLKEKASECLAEAKEKGLLVDYRVLHVGDDLQLLMS
HRKGIDSEEIHKLAWETFEAATKIAKELKLHGAGQDLLSDAFSGNIKGMGPGIAEMEFTE
RGSETLVAFMMDKTEPGSFNFPIYKIFADPFNTAGLIIDPLLIDGFIFEVWNIKERKRIF
LKCPEDLYLLLSLIGAKSKYVIKRVFPKDSSPLPKDEPAVVVSTEKLFFIAEKYVGKDDP
VALVRAQSGLPALGEVLEPFSVPYLVSGWMRGSHNGPLMPVSFKDAQCTRFDGPPRVIAA
GFQISHGNFIGPIDLFDDPAFDLSRKKALELADYLRVQGPFEPHRLPPEEMEYTTLPGVL
KKLETRFEELE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttctgtaagtttaataaaagcagatgttggaggaattccaggtcattcg
actgtacatcccaaacttaaagaaaaggcctctgagtgtttggcggaggcaaaagaaaaa
ggattgttggtagattacagagttttacacgtaggcgatgatttacaactacttatgagt
catcgtaaggggattgattctgaagaaattcataaacttgcttgggaaacgtttgaagca
gcaacgaagattgctaaagagttaaagttacacggtgccggtcaagatctgctatcagac
gctttcagcggaaatattaaaggaatggggccaggcatagcagaaatggaatttacagaa
cgtgggtctgaaactttagttgcatttatgatggataaaacagaaccaggttcttttaac
tttcccatttacaaaatttttgcagatccattcaataccgcaggattaattattgaccct
ttgctaattgatggatttatatttgaagtatggaatataaaagaaagaaaaagaattttt
ctcaaatgtccagaagatttgtatcttttattatctttgataggtgcaaaaagcaaatat
gttataaaaagggtttttcccaaagattccagcccgctacctaaagatgaacccgctgta
gtagtaagcacagaaaagctattctttatcgcagaaaaatatgtagggaaagacgatcca
gtagcgttggtaagagcgcaatcaggcttaccagctttgggagaggtcttagaacccttt
agcgtaccttatttagtcagcggctggatgcgtggttcacataatggtcctttaatgccc
gtttctttcaaagatgctcaatgtacacgatttgatgggccacctcgtgtaattgcagct
ggcttccagataagtcacggtaattttatcggtcccatagatttgtttgatgatcctgct
tttgacctctctcggaaaaaagctttggaattagcagattacctaagggtacaaggtccc
ttcgaaccacacaggcttccacctgaagagatggaatatactacccttccaggagtatta
aaaaagcttgaaacaaggtttgaagaattggaataa

DBGET integrated database retrieval system