KEGG   Petrotoga mobilis: Pmob_1538Help
Entry
Pmob_1538         CDS       T00621                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00030  Pentose phosphate pathway
pmo00051  Fructose and mannose metabolism
pmo00680  Methane metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
pmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1538
   00030 Pentose phosphate pathway
    Pmob_1538
   00051 Fructose and mannose metabolism
    Pmob_1538
  Energy metabolism
   00680 Methane metabolism
    Pmob_1538
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pmob_1538
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pmob_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABX32239
JGI: Pmob1538
UniProt: A9BGJ9
Position
1668930..1670045
Genome map
AA seq 371 aa AA seqDB search
MEKVSVSLIKADVGGIPGHSTVHPKLKEKASECLAEAKEKGLLVDYRVLHVGDDLQLLMS
HRKGIDSEEIHKLAWETFEAATKIAKELKLHGAGQDLLSDAFSGNIKGMGPGIAEMEFTE
RGSETLVAFMMDKTEPGSFNFPIYKIFADPFNTAGLIIDPLLIDGFIFEVWNIKERKRIF
LKCPEDLYLLLSLIGAKSKYVIKRVFPKDSSPLPKDEPAVVVSTEKLFFIAEKYVGKDDP
VALVRAQSGLPALGEVLEPFSVPYLVSGWMRGSHNGPLMPVSFKDAQCTRFDGPPRVIAA
GFQISHGNFIGPIDLFDDPAFDLSRKKALELADYLRVQGPFEPHRLPPEEMEYTTLPGVL
KKLETRFEELE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttctgtaagtttaataaaagcagatgttggaggaattccaggtcattcg
actgtacatcccaaacttaaagaaaaggcctctgagtgtttggcggaggcaaaagaaaaa
ggattgttggtagattacagagttttacacgtaggcgatgatttacaactacttatgagt
catcgtaaggggattgattctgaagaaattcataaacttgcttgggaaacgtttgaagca
gcaacgaagattgctaaagagttaaagttacacggtgccggtcaagatctgctatcagac
gctttcagcggaaatattaaaggaatggggccaggcatagcagaaatggaatttacagaa
cgtgggtctgaaactttagttgcatttatgatggataaaacagaaccaggttcttttaac
tttcccatttacaaaatttttgcagatccattcaataccgcaggattaattattgaccct
ttgctaattgatggatttatatttgaagtatggaatataaaagaaagaaaaagaattttt
ctcaaatgtccagaagatttgtatcttttattatctttgataggtgcaaaaagcaaatat
gttataaaaagggtttttcccaaagattccagcccgctacctaaagatgaacccgctgta
gtagtaagcacagaaaagctattctttatcgcagaaaaatatgtagggaaagacgatcca
gtagcgttggtaagagcgcaatcaggcttaccagctttgggagaggtcttagaacccttt
agcgtaccttatttagtcagcggctggatgcgtggttcacataatggtcctttaatgccc
gtttctttcaaagatgctcaatgtacacgatttgatgggccacctcgtgtaattgcagct
ggcttccagataagtcacggtaattttatcggtcccatagatttgtttgatgatcctgct
tttgacctctctcggaaaaaagctttggaattagcagattacctaagggtacaaggtccc
ttcgaaccacacaggcttccacctgaagagatggaatatactacccttccaggagtatta
aaaaagcttgaaacaaggtttgaagaattggaataa

DBGET integrated database retrieval system