KEGG   Petrotoga mobilis: Pmob_1540Help
Entry
Pmob_1540         CDS       T00621                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmo  Petrotoga mobilis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pmo00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1671615..1672220)
Genome map
AA seq 201 aa AA seqDB search
MFENNKTPYDFTNYIVNILKLSPSNTAILCVDCQNGFTERCPNELPVVGTNEEWIDQVNE
FLTLMKERNFKIFASMDDHPENHISFEKWPPHCIKGTYGNQLFINTYDFIIKKGEEVDGD
SYSAFYKDIERRIESELDELLRKHKIENLVVLGLAGDVCVIATIEDALKRGYKVFPISQY
IKAVNKKDIKELIEEKFGRII
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaaacaacaaaacaccttacgattttaccaattatatagtaaacatattgaaa
ttatctccttcaaacacagcaatattatgtgttgattgtcaaaacggatttaccgaaaga
tgtcctaacgaacttccagtagttggaacaaatgaagagtggatagatcaggtaaacgag
tttttgactttaatgaaagagagaaattttaagatttttgccagtatggatgatcaccct
gaaaatcacatctcttttgaaaaatggccccctcactgcataaaaggaacttatgggaat
caactatttataaatacctatgatttcattataaaaaaaggcgaagaagtagatggggat
agctattcagcattttacaaagacattgaaagaagaattgaatcagaattagacgaactt
ttgagaaagcataagatagaaaatttagtagttttaggcttagcaggagacgtatgcgtc
atagcgacgatagaagatgctttaaaacgaggatataaggtattcccaataagccaatat
ataaaagctgttaacaaaaaggatattaaagaactcatagaagaaaaatttggtagaata
atctag

DBGET integrated database retrieval system