KEGG   Petrotoga mobilis: Pmob_1540Help
Entry
Pmob_1540         CDS       T00621                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmo  Petrotoga mobilis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pmob_1540
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Pmob_1540
    3.5.1.-  
     Pmob_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1671615..1672220)
Genome map
AA seq 201 aa AA seqDB search
MFENNKTPYDFTNYIVNILKLSPSNTAILCVDCQNGFTERCPNELPVVGTNEEWIDQVNE
FLTLMKERNFKIFASMDDHPENHISFEKWPPHCIKGTYGNQLFINTYDFIIKKGEEVDGD
SYSAFYKDIERRIESELDELLRKHKIENLVVLGLAGDVCVIATIEDALKRGYKVFPISQY
IKAVNKKDIKELIEEKFGRII
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaaacaacaaaacaccttacgattttaccaattatatagtaaacatattgaaa
ttatctccttcaaacacagcaatattatgtgttgattgtcaaaacggatttaccgaaaga
tgtcctaacgaacttccagtagttggaacaaatgaagagtggatagatcaggtaaacgag
tttttgactttaatgaaagagagaaattttaagatttttgccagtatggatgatcaccct
gaaaatcacatctcttttgaaaaatggccccctcactgcataaaaggaacttatgggaat
caactatttataaatacctatgatttcattataaaaaaaggcgaagaagtagatggggat
agctattcagcattttacaaagacattgaaagaagaattgaatcagaattagacgaactt
ttgagaaagcataagatagaaaatttagtagttttaggcttagcaggagacgtatgcgtc
atagcgacgatagaagatgctttaaaacgaggatataaggtattcccaataagccaatat
ataaaagctgttaacaaaaaggatattaaagaactcatagaagaaaaatttggtagaata
atctag

DBGET integrated database retrieval system