KEGG   Petrotoga mobilis: Pmob_1621Help
Entry
Pmob_1621         CDS       T00621                                 

Definition
aspartyl-tRNA synthetase
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
pmo  Petrotoga mobilis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:pmo00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1772926..1774725)
Genome map
AA seq 599 aa AA seqDB search
MFQKRTHTCGELNENDIDKIVILNGWIDRIRDLGGIIFVLIRDRYGKTQAVFDSSDNYTL
YQKALKLKNEYVVSIQGKVRVRPEKDKNPNMVTGNIEILATNLEILSESETPPIYVNIEE
DISENLRLKYRYLDLRKERMQRNLILRHKVMKITRDTLSAEGFLEIETPYLTKSTPEGAR
DFLVPSRLKPGNFYALPQSPQLFKQLLMVSGFDKYFQIARCFRDEDFRADRQPEFTQIDI
EQSFVEKEDIFALTEKLIKEIFEKSLNYNGLEIPFQKYTYDEVIQKYGSDKPDIRYGMEF
IDLTAYFQNTEANFIKNGIDKGLILKGFIVPDRSNNFSRKKFDDLTEFAKEQGSSGLIWI
ACDKEMRSNIKKAAAKEINILVERGIMKEGDVLFAILEETDKIDQILGQLRIKMIKEEFE
KKSGFSIIWVTDFPMFSWNEEEQRIVAEHHPFTMPNLDDLAKYENKDPLKIKSQSYDLVI
NGYEIASGSIRIHKQDVQEKVFDILGLSKEEAQEKFGFLLEAFKYGAPPHGGIAIGMDRL
VSILVGEESIKEVIAFPKTASGTDPMTNAPSEVSEKQLEELHLALKKINESEKQNDSKS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttgttccaaaaaagaactcacacttgtggagaattaaacgaaaacgatatagataagatc
gttattttaaacggctggatagataggattcgtgatttaggaggaattatctttgttttg
ataagagatagatacggtaaaactcaggcggtttttgattcaagcgataactatacgctt
tatcaaaaagccttaaaattaaaaaacgaatacgttgtttctatccaagggaaagttagg
gtgcgtcctgaaaaagacaaaaacccaaatatggttactggaaatattgaaatactcgct
acaaatttagaaatcctttctgaatctgaaacaccacccatatacgtcaacatagaagaa
gatatttcggaaaacttaaggttaaaatatagatatttagacttgagaaaagaacgaatg
caaaggaatctaatactgagacacaaggttatgaaaatcacaagagatacgctaagcgct
gaaggcttcctggaaattgagaccccttacttaacaaaatcaacaccagaaggggcacgc
gattttttggttccttctagattgaaacctggcaatttttacgccttacctcaatctcct
caacttttcaaacaactgctcatggtatcaggttttgataaatattttcaaatagctcgt
tgtttcagagatgaggattttagggctgataggcaacccgaattcacacaaattgacata
gaacagtcctttgttgaaaaagaagatatatttgcattaacagaaaaattaatcaaagaa
atattcgaaaagtctctaaattacaatggattagagattccatttcaaaaatatacctat
gatgaagtgatacaaaaatatggttcagataaacctgatatacggtatggtatggaattt
atcgacctaacagcatattttcaaaacactgaggctaatttcataaaaaacgggatagat
aaaggtcttatattaaaaggttttattgtccctgatagatccaacaatttttccagaaaa
aaatttgatgacctgacagagttcgctaaagaacaaggaagctctggcttgatatggatc
gcttgtgacaaagaaatgagatcaaatataaaaaaagccgcagccaaagagattaatatc
ttagtagaacgtggtataatgaaagaaggtgacgttttattcgctattttagaagaaaca
gataaaatagaccagattttaggccaattgagaataaaaatgattaaagaagagttcgaa
aaaaaatccgggttcagtataatctgggtcacagattttccaatgttttcttggaatgag
gaagaacaaagaattgtagccgaacatcacccctttactatgcccaacttagatgattta
gctaaatatgagaataaagaccctttaaagattaaatctcaatcttatgatcttgtaata
aatggttatgagatcgcaagtggtagcataagaatacacaaacaagatgtacaagaaaag
gtgttcgatattttaggcttgagcaaagaagaggcacaagagaaatttggtttcttgtta
gaggctttcaaatatggtgctcctcctcacggaggtatagcaattggaatggatagattg
gtgagcatactagtaggagaagaatcaataaaagaggttatcgcattcccaaaaacagct
tctgggaccgatcccatgaccaatgctccatcagaagtcagcgaaaaacaattggaagaa
ttacacctcgctttgaaaaaaataaacgagagtgagaagcaaaatgactcaaaaagctaa

DBGET integrated database retrieval system