KEGG   Petrotoga mobilis: Pmob_1728Help
Entry
Pmob_1728         CDS       T00621                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00260  Glycine, serine and threonine metabolism
pmo00750  Vitamin B6 metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01230  Biosynthesis of amino acids
Module
pmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1728
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pmob_1728
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pmob_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR HypA DUF1610 NOB1_Zn_bind zinc_ribbon_10 zinc_ribbon_2 Rtf2 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ABX32421
JGI: Pmob1728
UniProt: A9BIT3
Position
1891989..1893254
Genome map
AA seq 421 aa AA seqDB search
MEGRKLKYVKDLVCISCGEKYEASPTQYLCPKCGEKGILDVEYDYEKIKKDWNKQDLKAN
PDPSIWRYSPLLPIEPNTPKPPLKIGGTPLYKSDVMAKLLGIETLYIKDDGLNPTGSLKD
RASAIAVVKAQEAGMNIVACASTGNAASSLAGNIASMGNEMKAVIFVPSRAPIGKVTQLL
VFGALVLSVKGSYEETFYLSQQAIDKWGWYNRNAAINPYLVEGKKTSSIEIAEQLNWEMV
DWLVYSVGDGCTIAGAWKGMYDLKQIGFIDKLPRLLGVQSEGCAPITQAFKSDTDLVPVP
ENTIADSIAVGKPRNYIKAIKAVKDSNGDMINVTDDEILNMIKILGKNTGIFGEPAGVAG
VAGIKKAVENGIIKPSESVAVVVTGNGLKDIKNAEKATGAPLSLDPNLNELSQLLEKYNF
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttggaggggagaaaactgaaatatgtaaaagatttggtttgtatttcttgtggggaaaaa
tacgaagcttcaccaacacaatatctttgcccaaaatgtggagaaaaaggtattttagat
gttgaatacgattacgaaaagataaaaaaagattggaataagcaagatttaaaagcaaat
cctgatccatctatatggagatattcaccactcttacctatagaacctaacacccctaaa
ccccctttgaagattggaggcacacctttatacaaaagtgatgttatggcgaaactgtta
ggtatagaaaccctttacattaaagatgatggtttaaatccaacaggatctttgaaagat
agggcttcagctatagctgttgtaaaagcacaagaggcaggcatgaacatcgttgcctgc
gcttctactgggaacgctgcctcttcgttggcggggaacatagcatctatgggaaatgaa
atgaaggctgttatttttgttccctcgcgagccccaattggaaaagttactcagctattg
gtttttggagctttagttttatcagtaaaggggtcttatgaagaaactttttatctatca
caacaagctattgataagtggggctggtataacagaaacgctgcgataaacccctactta
gttgaaggtaaaaaaacttcttcaattgaaatcgctgaacaattaaattgggaaatggtt
gattggttagtttactccgtgggtgatggctgcacaatagcaggtgcttggaaaggtatg
tatgatttaaaacaaataggattcatcgataaactaccaaggctattaggggtgcaatct
gaaggctgtgcgccaattactcaggcatttaaaagcgatacagatcttgttccagttccc
gaaaataccatcgctgatagcattgctgttggaaaacctcgaaattatataaaagctatt
aaagcagttaaagattcaaatggtgatatgatcaatgtaacagatgatgaaatactaaat
atgataaaaattttaggaaagaatactggcatttttggtgaacctgcaggagttgcagga
gtggctggtataaaaaaagctgttgaaaacggcataatcaaaccttctgaaagtgttgcg
gttgttgttactgggaacggtctgaaagatattaaaaatgctgaaaaagcaacgggcgct
cctttgtctttagatccgaatttaaatgaattatctcaactattagaaaaatataatttt
aaataa

DBGET integrated database retrieval system