KEGG   Petrotoga mobilis: Pmob_1822Help
Entry
Pmob_1822         CDS       T00621                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmo  Petrotoga mobilis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pmob_1822
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pmob_1822
Enzymes [BR:pmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Pmob_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2006306..2007808)
Genome map
AA seq 500 aa AA seqDB search
MRIPSNKLLQFLNGNIKKKVIKNEILNIADIKDNSENVEKDDIFIAFKGSRFDGHDFILS
AFDKGASLIIAQDEEKIPTNDSLQYIIVEDIKKAAADLSHKLFDISPDDFKILGVTGTNG
KSTTVSLVHHILQKSDKDSTLISTVEIKIKDEVVKEPYNTTPSILELSKILKNSKENNIE
FINMEVSSHAIHQRRIEGVKFDIISFTNITRDHLDYHKDFEEYKSIKLSLMNYLKDEGKI
VINLDRLNKDDFVKSGKEVITYGFKKNADFVIENYEQTLQQMKFTIKTKEHKSYEIRSHL
IGKFNVYNITNAFVIATLFGLEPEKIIYSISTFKGVSGRFQIVPGSKSLGFFAVIDFAHT
PDALNEVLKTASSITEGRIITVFGAGGNADKGKRKLMGQVVSEHSDVIVLTNDDPKDEDP
DQIIEDVSKGIDQDKHFIVIPDRETAIDTALRFANKGDIVIIAGRGHEKYQLFANGKKVK
FNDYEVTKKLIDKIKRSSGR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcccttcaaacaaactactacaatttttaaacggtaatataaaaaagaaagta
atcaaaaatgagatattgaatatagcagatatcaaagacaacagtgaaaacgttgaaaaa
gacgatattttcatcgctttcaaaggttcccgcttcgatggtcatgattttattctttca
gcatttgataaaggtgcttcattaataattgctcaagacgaagaaaaaattccaacaaat
gattctctgcaatacataatcgtagaagatattaaaaaggctgctgctgatttatctcac
aaattattcgacatctctccagatgattttaaaatacttggagtaaccggcactaatggc
aaatctacaacggtatctttagttcatcacatcttacaaaaatcagataaggactcgacg
ctaataagtaccgtagaaattaaaataaaagacgaggtagttaaggaaccatacaacacc
actcccagtattttagagttgtccaaaatattaaaaaacagcaaagaaaataatattgaa
tttattaacatggaagtatcgtctcatgcgatccatcaaagaagaattgaaggcgttaaa
ttcgatatcatatctttcacaaacatcacaagggatcatttggactatcataaagatttt
gaagaatacaaaagtatcaaattatccctgatgaactatttaaaagatgaaggaaaaata
gtaataaatctagacagattgaacaaagacgacttcgtaaaaagtggaaaagaagttatc
acctatggatttaaaaaaaacgcagactttgtgatagaaaattacgaacaaacgcttcaa
caaatgaaattcacgatcaagacaaaggaacacaaaagttatgaaatacgatcccacttg
atagggaaattcaacgtttacaatataacaaatgcctttgtaatagcaaccctatttgga
ctagaaccagagaaaatcatctattccatttccacctttaaaggtgtctctggaaggttc
caaatcgttccaggcagcaaatcgctaggtttctttgcagttatcgattttgcgcacacc
cccgatgcactcaacgaagtattaaaaaccgcttcatcaataactgaaggtaggataatc
acagtatttggggctggaggaaacgcagacaaggggaaacgaaagttaatgggacaagtt
gtaagtgaacattcggacgttatagttctcaccaacgatgatccaaaagatgaagaccct
gaccaaataatagaagacgtatcaaaaggtatagaccaagataaacatttcatcgttata
cccgatagagaaaccgccatagatacagccctaagatttgctaacaaaggggacatagta
atcatagcgggaagaggccatgaaaaatatcaactcttcgccaatggaaaaaaggttaag
ttcaacgattacgaagtaacaaaaaaactaattgacaaaatcaaaaggagttcgggaagg
taa

DBGET integrated database retrieval system