KEGG   Petrotoga mobilis: Pmob_1830Help
Entry
Pmob_1830         CDS       T00621                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
pmo  Petrotoga mobilis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pmob_1830 (gltX)
Enzymes [BR:pmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Pmob_1830 (gltX)
Amino acid related enzymes [BR:pmo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Pmob_1830 (gltX)
Transfer RNA biogenesis [BR:pmo03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Pmob_1830 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2014668..2016134
Genome map
AA seq 488 aa AA seqDB search
MISNTVRTRFAPSPTGYLHVGGARTALFNYLFSKKNEGKFILRIEDTDIERSTKESEDQL
INTLKWLNLNWDEGPIIGGDYEPYRQSERLEIYQRRAKELIEKGKAYEAYISPEEIEEVK
NQLISEGKPPHYTYDLISKYNTKERIEEYNYKGLKPVIFLKMPQKDYELDDKIKGKVIFK
KGSIGDFIILRSNGIPTYNFAVVVDDIEMKITHVIRGDDHLPNTLRQMAIYEAFEVEPPI
FAHVSMILGPDGKKLSKRHGATSVEEFMVQGYLPEAVDNYLALLGWSHPEGKEILPLSEI
IDNFTLDRVNSSPAIFDEKKLKWMNGQYLRNKPLEEIYQLAEPFVTGSKLLSKEQYEVNK
KWVIKALETILSSVEILSEIPEKMEVFLKDVYPDTNDPEFKEYFDKRGVKEAINLIYKYF
NEDDRWDTQTITENLKNAMNEANPQKKPFYMSLRKILTDSFHGPDLINTIFLLGRNTVLE
RLQRVIEI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaaatactgtaagaacaaggtttgcaccaagtccaacaggatatctccacgtt
ggtggagctagaacggcactttttaattatctcttttccaaaaaaaatgaaggaaaattt
atcttaagaatcgaagatacagacatagaacgttcaacaaaagaatctgaagatcaactt
ataaacactctaaaatggttgaatttgaattgggatgaaggacctataattggcggagat
tatgaaccttatcgccaaagtgaaaggttagaaatctatcagcgaagagcaaaggaacta
atagaaaaaggtaaagcatacgaggcatatatctcaccagaagaaatagaagaagtaaaa
aaccagttaataagcgaaggtaaaccgccacattatacctatgatttgatttcaaagtac
aacacaaaggaaagaattgaagagtacaattacaaagggttaaaacccgttatttttttg
aagatgcctcagaaagattatgaactcgatgataaaataaagggtaaagttatctttaag
aaaggttctattggtgattttataattttaagaagtaatggtatacctacatataatttt
gctgtcgttgtagacgatatcgaaatgaaaatcacccatgttatcaggggggacgatcat
ttaccaaatactttgcgacaaatggcgatttatgaggcttttgaggtggaacccccaata
tttgcacatgtttcaatgatcttgggaccagatggcaaaaaattatccaaaagacatgga
gctacctctgtcgaagagtttatggttcaaggatatttgcctgaagctgttgacaattat
ctggcactgcttggttggtctcatcctgagggtaaggaaatattgcctctctctgaaata
attgataattttactttggatagagtcaattcaagccctgcaatattcgatgagaaaaaa
ttaaaatggatgaatgggcagtatctaagaaataagcctttggaagaaatctatcaactt
gcagaaccttttgtgactggatcaaaacttctaagcaaagaacaatatgaagtaaacaaa
aaatgggttattaaagctttagaaactattctttcttctgttgaaatattgagcgaaata
cctgaaaaaatggaagtttttttaaaagatgtttatccagatacaaacgatcctgaattt
aaagaatactttgataaaagaggagtaaaagaagctatcaacttgatttataagtatttc
aatgaagatgacagatgggatacacaaactataacagagaatttaaagaatgctatgaac
gaagccaatcctcaaaagaaaccattttacatgtctttaagaaaaattttaacggattca
tttcatggacccgatttgataaatacgatatttttattaggtaggaatactgttttggaa
agacttcaaagggtgatcgagatttga

DBGET integrated database retrieval system