KEGG   Petrotoga mobilis: Pmob_1916Help
Entry
Pmob_1916         CDS       T00621                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmo  Petrotoga mobilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmob_1916
   01230 Biosynthesis of amino acids
    Pmob_1916
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1916
   00030 Pentose phosphate pathway
    Pmob_1916
   00051 Fructose and mannose metabolism
    Pmob_1916
   00052 Galactose metabolism
    Pmob_1916
  Energy metabolism
   00680 Methane metabolism
    Pmob_1916
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pmob_1916
Protein phosphatases and associated proteins [BR:pmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pmob_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2121021..2122028
Genome map
AA seq 335 aa AA seqDB search
MKYKIIKIFRRDTVSEVKKIGLMTSGGDAPGMNAVIRAVTRSAVVENIEVYGFLRGFAGI
LDKEYKKLTYSDVGGIMERGGTILRTSRVPEFKVPEVRKKAADILKDLGIDVLVIIGGNG
SLTGGKLLAEEQGISVVGVPASIDNDIAYTDMSIGVDTCLNTVVDAMQKLKDTASSHERA
FIVEVMGRTSGYIALMSGLAIGAEAIIIPEVPTDYDALAEKMWDERKRGKINSIVVVAEG
SASAYTVARHLENRIGFETRITILGHIQRGGSPTAFDRILASRMGNEVVKSIKDGNFNVM
VGLSKNDLIRTPLEKVLSENNKLDMEIVKLAGILS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaaataataaagatttttaggagggatacagtgagtgaggttaaaaaaatc
ggtttaatgaccagtggtggagatgcacctggaatgaacgctgttattagggctgttaca
agaagtgcagtagtggaaaatatcgaagtgtatgggtttttgagaggatttgctggtatt
ttagataaagaatataaaaaactaacatattcagatgttggtggaataatggaaagaggg
ggaaccattttaagaacctctcgagtaccagaattcaaagttcctgaagttagaaaaaaa
gctgctgatatattgaaggatttaggtatagatgtgttagttataattgggggtaacggg
agtcttactgggggaaagttgctagcagaagaacaagggatatctgtagtaggcgtaccg
gcttctatagacaacgatattgcatataccgatatgagcataggtgttgatacctgtctt
aacacagtagttgatgccatgcaaaagttaaaagataccgcttcttcccacgaaagggct
tttatcgtcgaagttatgggaaggacatctggatacatagcgttgatgtcaggtcttgct
ataggtgcggaagctataataataccagaagttcccaccgattacgatgctttagcagaa
aaaatgtgggatgaaagaaaaaggggtaagattaattcaatagtcgttgttgcggaggga
tctgccagcgcctatacagtcgccagacatttagaaaatagaattggttttgaaacgcgt
ataacaattttaggccatattcaaagagggggttctcctactgcattcgatagaattttg
gcttcgagaatggggaacgaagtagtaaaatcaattaaagacggaaattttaacgtgatg
gtgggcttgagtaaaaacgatttaataagaacacctcttgaaaaagtgctttctgaaaat
aataaattggatatggagattgtaaagctggcagggattttatcctag

DBGET integrated database retrieval system