KEGG   Pseudomonas monteilii SB3078: X969_03945Help
Entry
X969_03945        CDS       T02972                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pmon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    X969_03945
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    X969_03945
  Energy metabolism
   00680 Methane metabolism
    X969_03945
Enzymes [BR:pmon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     X969_03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835398..838025
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHVLGELLGDTIRLQHGEAFLQKIEDIRHSAKADRRSAGEQLSSTLADL
ADEDLLPVARAFNQFLNLANMAEQYQLIRRRDADHPEPFEARVLPELLARLKQAGHSNDA
LARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTPGERQQVRERLRRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPSHLRKVDKALLEATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDALASELSMQQADDALRE
QVGDSAEPYRSLLKQLRDRLRATRAWAHSALTSSQPASAEVLVDNRDLIAPLELCYQSLH
ACGMGVIAEGPLLDCLRRAVTFGLFLGRLDVRQDAARHRDALSEITDYLGLGRYADWDEE
QRIEFLQAELKNRRPLLPAHFKPQADTAEVLATCREIAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMQRLLGLPGYRANLRGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICAEHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPQPAWREVMDQLAADG
VKAYRGVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALNNALARGQGELLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPHLLPLGAHLRDLLSQSCQVVLGLTGQPVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgatgtgcgtttgcgtgaagatgtccatgtgttgggtgaactgcttggc
gataccattcgcctgcagcatggcgaggcgttcctgcagaagatcgaagacatccgtcac
agtgccaaggccgaccgccgtagcgccggcgagcaactgagctcgaccctggcggacctg
gccgatgaagacttgctgcccgtggccagggccttcaaccagttcctcaacctggccaac
atggccgagcagtaccagttgatccgccgccgcgacgccgaccaccccgagccgttcgag
gcccgggtgctgcccgagttgctggcgcgcctgaagcaggccgggcacagcaatgatgcc
ctggcccggcaattggccaagctcgacatccagctggtgctcactgcgcaccccaccgaa
gtggcccgccgcaccctgatccagaagtacgacgccatcgccggccaactggctgcccag
gaccaccgcgacctgaccccgggggagcgccagcaggtgcgcgagcgccttcgccggctg
atcgccgaggcctggcacaccgaagaaatccgccgcacccgaccgacgccggtagatgaa
gccaagtggggctttgcggtaatcgagcattcgctgtggcacgccattcccagccacttg
cgcaaggtcgacaaggccctgctggaggctaccggcctgcgcctgccgctggaagcggcg
ccgatccgcttcgcctcgtggatgggcggtgaccgtgatggcaaccccaacgtgaccgca
gcggtcacccgcgaagtcctgctgctggcgcgctggatggctgccgacctgttcctgcgc
gacatcgatgcgctggcttccgagttgtccatgcagcaggcggacgatgcgctgcgtgag
caggtcggcgacagtgccgaaccctaccgctccctgctcaagcaactgcgcgatcgcctg
cgagcaacgcgcgcgtgggcgcattcggcattgaccagcagccagccggccagcgccgag
gtgctggtggacaaccgcgacctgatcgcgccgctggagctgtgctaccagtccctgcac
gcctgcggcatgggtgtgatcgccgaaggcccgttgctcgactgcctgcgccgcgccgtg
acctttggcctgttcctgggccgcctggacgtgcgccaggacgccgctcgccaccgtgat
gcgttgagcgagattaccgactacctgggcttggggcgttatgccgactgggatgaagag
cagcgcatcgagttcctccaggccgagctgaaaaaccgccggccactgctgcccgcgcac
ttcaagccgcaggccgataccgccgaggtactggccacctgccgggaaattgccgctgcg
ccggccgcctcgctgggctcttacgtcatctcgatggccggtgctgcctcggatgtgctg
gcggtgcagttgctgctcaaggaggccggcctgactcggcccatgcgcgtggtgccgctg
ttcgagaccctggccgacctcgacaatgccggcccggtgatgcagcgcctgctcggcctg
ccaggctaccgtgcgaacctgcgcggcccgcaggaagtgatgatcggctattccgactcg
gccaaggacgctggtaccacggctgcggcctgggcgcagtaccgggcccaggaaaacctg
gtgcgtatctgcgccgagcaccaggtcgaattgctgctgttccacggccgtggcggcacg
gtaggccgcggcggcggcccggcccacgcagcgatcctgtcgcagccaccagggtcggtg
gcggggcgcttccgcaccaccgagcagggcgagatgatccgcttcaagttcggtttgccg
ggcatcgccgagcagaacctgaacctgtatctggctgcggtgctggaggccaccttgttg
ccaccgccaccaccgcagccggcctggcgcgaggtgatggaccaactggccgccgatggc
gtcaaggcctaccgcggcgtggtgcgggagaaccccgattttgtagagtatttccgccag
tccaccccggagcaggaactggggcgcctgccgctgggcagccgaccggccaagcgccgc
gccggtggcatcgaaagcctgcgggccatcccgtggattttcggctggacccagacccgc
ctgatgctgccagcctggcttggttgggaaacggcattgaacaatgcactggcgcgtggc
cagggtgaactgctggcgcagatgcgcgagcaatggccgttcttccgcacccgcatcgac
atgctcgagatggtgctggccaaggccgatgcgcagatcgccgaggcctacgacgaacgt
ctagtgcaacctcacctgctgcctttgggtgcgcacctgcgcgacctattgtcgcagtcg
tgccaggtggtactgggccttaccgggcagccggtgctactggcgcacagccccgagacg
ctggaattcatcagcctgcgcaatacctacctggacccgttgcaccgcctgcaggccgag
ttgctggcccgctcgcgcagccgcgaagccgctctggacagcccgttggagcaggccttg
ctggtgactgtggcgggtatcgcagccggcctgcgcaataccggctga

DBGET integrated database retrieval system