KEGG   Pseudomonas monteilii SB3078: X969_08410Help
Entry
X969_08410        CDS       T02972                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmon00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X969_08410
Enzymes [BR:pmon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     X969_08410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1788314..1789222
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVARAQRLPRAGETLPGESFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVTTCQGVSSGVALITVDAASQNCIVIIPGGNGLLTP
QSVQRFDALLQAAEVIICQLEVPADTVAWTLARGRELGKRVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVTVTDLDSARRAGERLLQLGAGKVIITLGAQGALLVTPQGHQHFP
APVVQPLDTTAAGDTFIGGFAAGLVRGLGEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
AP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtagtcggtagcctcaacatggacctggtggcccgcgcgcag
cgcctgccccgggccggcgaaacactccccggcgaaagctttttcaccgtgccgggcggc
aagggggccaaccaggcagtggccgtggcgcgcctgggcggcagcgtggcgatgatcggc
aacgtcggcgacgatgactatggtcgacaactgcaccgggccctgtatgtggaaggcatc
gactgccagggcgtcaccacctgccagggcgtgtccagcggggtggcgctgatcaccgtg
gatgccgccagccagaactgcatcgtcatcatccccggtggcaacggcctgctgacgccg
cagtcggtgcagcggttcgatgcgctgctgcaggcggctgaagtgatcatctgccagctg
gaagtaccggccgacaccgtggcctggaccctggccagagggcgcgagctgggcaagcgg
gtaatcctgaacccggcgccggcgaccggccccttgccggcggactggttcgcccacatc
gactacctgacgcccaacgaaagcgaggccgaagccctgaccggcgtgacggtgactgac
ctggacagtgcccgacgtgccggcgagcgcttgctgcaactgggcgcgggcaaagtgatc
attaccctgggcgcgcaaggggccttgctggtcaccccgcagggccatcagcacttccct
gcgccggtggtacagccgctggacaccacggcagccggcgataccttcatcggcggcttt
gccgctggcctggtgcgcggcctgggggagggcgaagccatcgctttcggccagcgcgcc
gcagccctgtcggttacccgcgccggcgcccagccgtcgattccctacctggcggagctt
gcgccatga

DBGET integrated database retrieval system