KEGG   Pseudomonas monteilii SB3101: X970_08180Help
Entry
X970_08180        CDS       T02973                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmot00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    X970_08180
   00330 Arginine and proline metabolism
    X970_08180
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    X970_08180
Enzymes [BR:pmot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     X970_08180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1759950..1760858
Genome map
AA seq 302 aa AA seqDB search
MQTLLNEILEEVRPLIGKGKVADYIPALADVPANQLGIAVYGNDGSYYCAGDALVPFSVQ
SISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPTLSMRDFVRRLSGNPHISIDARVADSEYQFRARNAAMAYLMQSFGNFHNEVE
TVLRSYFSYCALQMNCLDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAIVPGQFTVCVWSPELNAAGNSLAGMAALELLSSRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgttgaacgagattctcgaagaagtacgtcccttgatcggcaagggcaaa
gtggctgactacattcccgcgctggccgatgtgccggcgaaccagctgggcatcgcggtc
tatggcaacgatggcagctattactgtgcaggcgacgcgctggtgccgttctcggtacag
agtatttccaaggtgttcagcctggtgcaggcgatcgggcactccggggaagccatttgg
cagcggcttggccatgagccttccggccagccgttcaactcgctggtacagctggagttc
gaacgcggtcggccgcgcaacccctttatcaatgcgggtgcgttggtgatctgcgatatc
aaccagtcgcgctttgctgcacccactttgtcgatgcgcgattttgtgcggcggctatcg
ggcaatccgcacatctcgatcgatgctcgcgttgccgattcggagtatcaattccgcgcg
cgcaacgcggccatggcttacctgatgcagtcgttcggcaacttccataacgaggtggag
acggtgctgcgcagctatttcagctattgcgcgctgcagatgaattgcctggacctggcc
cgggcgttctgtttcctggccaatgatgggttctgcaagcacagcggtgagcagattctg
acccggcgccagacccagcaggtgaactcgatcatggccactagtgggttgtatgacgaa
gcagggaatttcgcctatcgggtggggttgccgggcaagagtggtgtagggggtggcatt
gtggcgatcgtgccggggcaattcaccgtgtgcgtgtggtcgccggaattgaatgctgcg
ggtaactccctggccgggatggcggcgctcgaactgctcagttcgcggatcggctggtcg
gtgttctga

DBGET integrated database retrieval system