KEGG   Pasteurella multocida 36950: Pmu_01260Help
Entry
Pmu_01260         CDS       T01729                                 

Gene name
galM
Definition
galactose mutarotase, aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_01260 (galM)
   00052 Galactose metabolism
    Pmu_01260 (galM)
Enzymes [BR:pmp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Pmu_01260 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131415..132446
Genome map
AA seq 343 aa AA seqDB search
MLSKCTLGVAPDGQPFQLVTLSNAKGMSIQVMDWGATWLSCKVPVQNQLREVLLGCQLED
YPKQQVYLGATIGRYANRIANGRFVLNGVPIQLQTNQGQHQLHGGENGFDCQRWQLEKCG
ENFVCFSLSSPDGDQGFPGHVKVRVTYLLSEQNCVEIQFEAESDQDTPLNLTNHAYFNLN
NAELGEDIREHYLQVNADHYLPVNPEGIPCAALKSVQGTSFDFREMKSIEKDFLQDEQAL
VKGYDHAFLLNQDKEKLSAVLTAADGSLRLQVSTSQPALQVYTGNFLAGTPNRFGSYYQD
YVGIALETQALPDTPNHPEWWTLGGMSQAGEKYQHWTRFNFSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcaagtgtacactgggtgtcgcaccagatggacaaccatttcaattagtcact
ttatccaatgcaaaagggatgtctatccaagtgatggattggggggcgacatggttgtct
tgtaaggtgcctgtgcaaaatcaattacgtgaggtgttattaggctgtcagcttgaggat
taccctaagcaacaggtttatttaggtgcgactatcgggcgttatgcgaatcgtattgcg
aatggacgttttgtattaaatggggtgccgattcagttacagacgaatcaaggacaacat
cagttacatggcggcgaaaatggttttgattgccaacgttggcaattggaaaagtgcggt
gaaaattttgtgtgtttttcactttcttcgccagacggtgatcaaggttttcccggtcat
gtgaaagtacgtgtaacgtacttactgagcgagcaaaattgtgtagaaattcaatttgag
gcggaaagtgatcaagacaccccgctaaatttaaccaaccatgcttattttaatctcaat
aacgcggagcttggtgaggacattcgagaacattatttgcaagtcaatgctgaccattac
ttacctgtgaatccagaggggatcccttgtgcagcgttgaaatccgtacagggcaccagt
tttgattttcgtgagatgaagtctattgagaaagactttttacaagatgaacaagcccta
gtaaaagggtatgatcatgcctttctattaaatcaagacaaagaaaaactcagtgcggtt
cttacggcagcagacggttctttacgtttacaggtctccacctctcaacctgccttacaa
gtatatactgggaattttctagccggcacgccgaatcgtttcggctcatactatcaggat
tacgtcgggattgcgttagaaacacaagccttacctgatacccctaatcatcctgagtgg
tggacattgggtggcatgagccaagccggagaaaaatatcaacattggacccgttttaac
ttttcatcataa

DBGET integrated database retrieval system