KEGG   Pasteurella multocida 36950: Pmu_01470Help
Entry
Pmu_01470         CDS       T01729                                 

Gene name
arnB
Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(152754..153923)
Genome map
AA seq 389 aa AA seqDB search
MLNTPFAPWPSFSAQEIDAVVKVLQSNQVNYWTGQVCREFEKEFAHYTQTKHAIALMNGT
VALDLALKALDIKAGDDVIVTSRTFLASASCIITAGANPVFADVELDSQNISRRTIEAVL
TPNTKAIICVHLAGLMCDMDPIMALAHERGLYVIEDCAQAHGAMYKGRSAGSIGHIGAWS
FCQDKIMTTGGEGGMVTTNDTVLWNKMWSYKDHGKSFDAVYHKTHPAGFKWLHESFGTNW
RMMEIQAAIGRIQLTKMPEWTKKRNQNMQRILTAFADSPYFTQHTLTPDYVHAAYKCYIQ
VNPKTLPQGWDRDRIMQHINALGVPCYSGSCSEVYLEKAFEHTTWRPNKRLENAKQLGET
SLMFLVHPTLTESDISRCVEVIKTVIEQI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatacaccttttgcaccttggccatccttttcagcacaagaaattgatgccgtc
gtcaaagtacttcagtctaatcaagtcaattactggacaggacaagtatgccgagaattt
gaaaaagaatttgcacactacactcaaacaaagcatgccattgcgttgatgaatggtaca
gttgcactggatcttgccttaaaagccctcgacattaaagcaggcgatgatgtgattgtg
acttctcgcacttttcttgcttcagcaagctgtattatcactgccggcgcaaatcctgtg
tttgccgatgttgagcttgattcacaaaatatctctcgtcgaactattgaagccgtttta
acgccgaatacaaaagctatcatctgtgtacatttagccgggctaatgtgtgatatggat
ccgattatggcgctggctcacgaaagaggattgtatgtcattgaagactgtgctcaagct
catggcgcaatgtataaaggacgttccgcaggttccataggtcacattggtgcctggtca
ttctgccaagacaaaatcatgacaactggcggagaaggcggaatggtgactacgaatgat
acggtcctttggaataagatgtggtcctataaagatcatggtaaaagttttgacgcggtt
tatcataaaacacatcctgcaggctttaaatggcttcacgaatcttttggcaccaactgg
cgcatgatggaaattcaagcggcgattggacgtattcaacttacaaaaatgccagaatgg
acgaaaaaacggaatcaaaatatgcaacgtattttgaccgcatttgctgattcaccttat
tttacgcaacatacactaacaccagattatgttcatgctgcctataaatgttacatacaa
gttaacccgaaaacactacctcaaggctgggatcgtgatcgtatcatgcaacatatcaat
gcattaggcgtgccttgttatagcggttcttgctcagaagtttatttagaaaaagcattt
gagcacaccacatggcgaccaaataaacgtttagaaaacgcgaaacaattaggggaaacc
agtttaatgtttttagtccatcctacattaactgaatcagacatcagtcgatgtgtggaa
gtgataaaaacagtaattgaacaaatttaa

DBGET integrated database retrieval system