KEGG   Pasteurella multocida 36950: Pmu_01530Help
Entry
Pmu_01530         CDS       T01729                                 

Gene name
wbjC
Definition
(GenBank) NAD-dependent epimerase/dehydratase WbjC
  KO
K19068  UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase [EC:1.1.1.367]
Organism
pmp  Pasteurella multocida 36950
Brite
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.367  UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase
     Pmu_01530 (wbjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_4 RmlD_sub_bind GDP_Man_Dehyd Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AET15113
Position
complement(158602..159723)
Genome map
AA seq 373 aa AA seqDB search
MKVLVTGSNGFIAKNLIQSLSEEQDIEILCYHRQSSEKTLIHHVLSADWIIHLAGANRPP
EEQEFMTSNTQLTEKICRILQRHQKKTPLLYSSSIQVESPKISTYSQTKLESEYHVHQLH
KENGNPIYICRLANVFGKWSRPHYNSVVATFCHNLIHDLPIEIHDHTAEIRLIYIDDVVD
TFCRLIAGKYQPQTTPFYINPEYKITVSELYQLLMSFKNTRNTLITSEVGTGLKRALYAT
YLSFLPPEKFTYVIPQYRDERGVFVEMLKTPSAGQFSYFSAQPGITLGGHYHHSKTEKFL
VIRGKALFKFKHVITGETYQLETHGEHPTIVETVPGWAHDITNIGHDEMFVMLWANEIFD
REKPDTYAMPITS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttagtaactggttcaaatggttttattgcgaaaaatctgattcagtcttta
tctgaggaacaagatattgagattttatgttatcaccgtcaatcctctgagaaaacgctt
attcatcatgtattgagtgctgattggattattcatcttgcgggtgcgaatcgtccacct
gaagaacaagaatttatgacatcaaatacacaattgacggaaaaaatttgccgtatttta
cagcgtcatcagaaaaaaacgcctttgttatattcctctagcattcaagtagaaagtccc
aaaataagtacttattcgcaaaccaaattagaaagtgaatatcatgttcatcaattacat
aaagaaaatggtaatccgatttatatctgccgtttagctaatgtctttggcaaatggtca
cgacctcactataactcggtagtcgccacattttgccataacttaattcatgatttaccc
atcgaaattcatgatcatactgcagaaataaggctcatttatattgatgatgtcgttgac
accttttgccgtcttattgcaggcaaataccaacctcaaactacgcctttttatatcaac
ccagaatataaaatcacggtaagtgagttatatcaactgctcatgtcattcaaaaataca
cgcaataccctgataaccagtgaggttggcacggggttaaagcgcgcattatatgccact
tatctcagtttcttaccccctgaaaaatttacctatgtgattccgcaatatcgagatgaa
agaggcgtttttgtcgaaatgcttaaaacaccgagcgcgggacaattctcttatttttca
gcacaacccggaatcaccctcggcggacactaccatcatagtaaaacagaaaaattctta
gtgattcgaggtaaagcgctgttcaaattcaaacatgtcataacaggggaaacttaccaa
ttagaaacacatggggaacatccgacgattgtcgaaacggttccgggttgggcacatgat
attacaaacattggtcatgatgagatgtttgtcatgttatgggcaaatgaaatatttgac
cgtgaaaaacccgatacgtatgccatgccaattacatcttaa

DBGET integrated database retrieval system