KEGG   Pasteurella multocida 36950: Pmu_01560Help
Entry
Pmu_01560         CDS       T01729                                 

Definition
(GenBank) glycosyl transferase, family 1 protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: AET15114
Position
complement(160734..161906)
Genome map
AA seq 390 aa AA seqDB search
MEKKNVLIFTGLYLPGVKGGGPIRTIYNLTSRLKNDINFYIITLDRDLGDPSPYKNIATN
TWTADENGTKIYYINPNFKIRELIKVVNQIDYDVLYLNSFFNFRFTIIPLFLNKFHFFKT
SKPIVLAPRGELSSSALSLKKCKKEIFTKLASWIGLYDQDIVWQGSSAHEINDIYTFLVK
NNITYKKIIECRNLSTPSSLTTSKEGINNQSRLRICFLSRIAKIKNLYFALEILQKIDFP
VFLGIYGPLEDKKYWNACLSLISKLPSHIEVKYYGIVENTKVQETISNYDLFFVPTQGEN
YGHVFIEALSSGTPILLSDQTPWRNLKDKGIGWDIPLARKDRFIHALQAFNHLNVEKRQI
IKQKCINFADSIINSKEVLDANKNIFLDLV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaatgttttgattttcacaggattatacttgcctggtgtgaaaggtggt
ggtccaattagaacgatttataatttaacctcacgccttaaaaatgacatcaacttttat
attattactttagatagagatcttggcgatccttcaccatataaaaatattgcaacaaat
acatggacagccgatgaaaatggcacaaagatttattatatcaacccaaattttaagata
agagaattaataaaagtcgttaaccaaattgactatgacgttctataccttaatagtttc
tttaattttagatttactattatcccgttatttttaaataaatttcatttttttaaaaca
agtaaacccattgttttagcaccacgtggggaattgtcatcaagtgcattatctctcaaa
aaatgcaagaaagagatatttacaaaactcgcatcatggattgggctctatgatcaagac
attgtctggcaagggtcaagtgcgcatgaaattaatgatatatatacattcttagtcaaa
aataatatcacttataaaaaaataattgaatgtagaaatctatcaaccccctcttcatta
acaacatccaaagagggaataaataatcaatcaaggttgagaatttgtttcttatcaaga
atagcaaaaataaaaaatttatatttcgcattagaaatactacaaaaaatagatttccct
gttttcttaggtatctatggaccattagaagacaaaaaatattggaacgcttgtttatca
ttaattagcaagctcccttctcatattgaagtgaaatattatggcatcgttgaaaataca
aaagtacaagaaacaatttcaaactatgatttatttttcgtgccgactcaaggtgaaaat
tacggtcacgtatttatagaagccctttcttctggcaccccaatattattaagcgaccaa
acaccttggcgaaatttaaaagataaaggcattggttgggatattcctttagcaagaaaa
gatcgctttattcatgctttacaggcgtttaatcatctcaacgtggaaaaaagacagatt
attaaacaaaaatgtatcaattttgctgacagcattattaatagcaaagaagtcttagat
gccaataaaaatatatttttggatttagtctaa

DBGET integrated database retrieval system