KEGG   Pasteurella multocida 36950: Pmu_01580Help
Entry
Pmu_01580         CDS       T01729                                 

Definition
(GenBank) putative membrane protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AET15116
Position
complement(163096..164334)
Genome map
AA seq 412 aa AA seqDB search
MLIRNTLLLTISHMLSRGSLIFSSVIISSLMDKEQFSIYSYFILTTTTISIYSALGIGIT
TNKFFSSLKKELNLETPVMTLWIINISLAILGGVIFTLLSEQIIPKSINFNKNYFSLVIL
FLCLDIYTSNALIGLGEYIKLCITSLLFFCINIIMVVIAILNNNIDYAILGLISGVIVQL
IFNTVFVLRYLSSIQLLEKVKIKIAHLKEILKTMGPMMFVSLFAASNTWIVSQYILVSNR
ESALEFNLFSIGLQWFSLALFLPSVFSRVLLNYFISHTHSNSLVIAKRNIALILSLFLLL
TFVSYIASPIIQGIYSRYTIPAILIPLFLFIAGINSSTNILGNILISQNQEWVWLIFVTI
GFLLLNILCALIKEIDSMTGTVIMLINNILIFSLSLFYLFVYKKPHKEEIKI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgttaatacgaaatacgctattactcacaataagccatatgttatctcgaggaagctta
attttttcttccgtgatcatatcaagcttaatggataaagaacaattctcaatctacagt
tatttcatattaacaacgacgacaatatctatttattctgccttgggaataggaatcacg
acaaataaatttttttcctcattaaaaaaagaacttaatttagaaacacccgtgatgaca
ctatggattataaatattagcctagcaatcttaggaggagtaatattcactctattatca
gaacaaatcattcctaaatcaattaactttaataaaaattatttttctcttgttattctt
tttttatgtttggatatttatacaagcaatgcgctcattggattaggagaatatataaaa
ttatgtattacatcactccttttcttttgcataaacattattatggtggtgatagcaatt
ttaaataacaatatcgattacgcgatactaggattaatctctggcgtgatagtccaactg
atctttaatacagtattcgtactccgatatctttcgagcatacagcttttagagaaagta
aaaataaaaatagcccacttaaaagaaattttaaaaacaatgggacccatgatgtttgtt
tctctctttgccgcatcgaatacttggatagtaagtcaatatattttagtttcaaacaga
gaaagtgcccttgagttcaatctcttttcaataggattacaatggttttcactggcgctc
tttttaccctctgttttttctagagtattactaaactattttatctctcatacacattca
aatagtttagtcatagcgaaaagaaatattgcgttgattctttccctatttttattgctc
acatttgtttcatatattgcatcacccatcattcaagggatttatagtagatacacgatt
cctgcaatattaatacctttattcttattcattgcaggaataaattcatctacaaacata
ttaggtaatattttgatttctcaaaatcaagaatgggtatggttaattttcgtaacaatt
ggttttctattgctaaacatactttgtgctttaataaaagaaatcgacagcatgactggt
acagtcattatgttaattaataacattcttatattttcactttctctgttttatttattc
gtttataaaaaacctcataaagaagaaataaaaatatga

DBGET integrated database retrieval system