KEGG   Pasteurella multocida 36950: Pmu_01720Help
Entry
Pmu_01720         CDS       T01729                                 

Gene name
trxA
Definition
(GenBank) thioredoxin
  KO
K03671  
thioredoxin 1
Organism
pmp  Pasteurella multocida 36950
Brite
Chaperones and folding catalysts [BR:pmp03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Pmu_01720 (trxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
180911..181231
Genome map
AA seq 106 aa AA seqDB search
MEVLHSTDATFTADVVNSDVPVLLDFWAPWCGPCRMISPILDEIAAEFSGKVKVVKINID
ENQATPAQLGVRSIPTLVLFKNGKAVATQVGALPKNQLANFINQNI
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattacattcaactgatgcaacatttacggcagacgtcgtcaattcagatgta
ccggtcttattagatttttgggcaccttggtgtggtccttgccgtatgatctctccaatt
ttagatgaaattgcagcagaattttcgggtaaagtgaaagtggtgaaaattaatattgat
gaaaaccaagcgacaccagcacaattaggtgtgcgtagtatccctactttagtcttattt
aaaaatggtaaagccgttgcgacacaagtgggtgctttaccaaagaaccaattagctaac
tttattaatcagaatatctag

DBGET integrated database retrieval system