KEGG   Pasteurella multocida 36950: Pmu_01890Help
Entry
Pmu_01890         CDS       T01729                                 

Definition
(GenBank) membrane protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AET15141
Position
198350..198760
Genome map
AA seq 136 aa AA seqDB search
MKLTQLFASLMVAGALTACAQNGADMKKAMEMKSSEPTFETAAYFCDVKGKKNQVVSATY
TFVNGKADSATVTINRQVVGHEMKLDSTYQDGVRFVEGNKVWSLDNGFAASTVGTTAAVM
FTDNNKILAKNCTNAK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaactcaactttttgcaagcttaatggttgctggcgcattaactgcctgtgca
caaaatggtgcggacatgaaaaaagcgatggaaatgaaatcatctgagccaacatttgaa
acagcagcttatttttgtgatgtgaaaggtaagaaaaatcaagttgtttcagccacgtat
acatttgttaatggtaaagcagatagcgcaacagtaacaattaatcgtcaagttgttggt
catgaaatgaaactcgatagcacttatcaagatggtgtgcgtttcgtagaagggaacaaa
gtctggtcattagataatggctttgcagcaagcacagtcggcacaactgctgcagtaatg
tttactgacaacaacaaaatcctagctaaaaattgtactaacgcaaaataa

DBGET integrated database retrieval system