KEGG   Pasteurella multocida 36950: Pmu_01950Help
Entry
Pmu_01950         CDS       T01729                                 

Definition
(GenBank) putative cytochrome oxidase subunit 2
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:1.10.3.14]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00190  Oxidative phosphorylation
pmp01100  Metabolic pathways
pmp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Pmu_01950
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pmu_01950
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Pmu_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II DUF2569
Motif
Other DBs
NCBI-ProteinID: AET15147
Position
203533..204669
Genome map
AA seq 378 aa AA seqDB search
MIDYEILRFVWWILIGVLLIGFAVTDGFDMGVLTLLPFAGKKEVEKRIMINSIAPHWDGN
QVWLLTAGGAMFAAWPIVYATSFSGFYIAMILVLAALFFRPVGLEYRAKIDNPTWRTLWD
WGLFIGGFVPSLVFGVAFGNLLQGVPFEFNELLQVKYTGSFFALLNPFALLCGLVSLAML
TTQGSAWLQMKTTSELRHRARSITQAGAVATIITFVLAGVWLYFKDGFVVTSVIDHNAPS
TPFGKTVAIEAGAWFNNYKDMPILWIFPLLAVVSAVLNILASKADRSGFAFLFSSLTMAG
IILTAGISMFPFVMPSITHPELSLLMWDSTSSKLTLTLMLGFALVFVVILLAYTIWAYWK
MFGRLDSQFIEENKNSLY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgattgattatgaaattctacgctttgtttggtggatcttgatcggtgtattgcttatt
ggttttgcagtaactgatggttttgatatgggtgttctaactttgttgccttttgctggt
aaaaaagaagtggaaaaacgtatcatgattaactccattgcaccacactgggacggtaac
caagtttggttattaacagccggtggcgcaatgtttgccgcatggccgattgtgtatgcc
acctctttctctggtttctatatcgccatgattttagttttagcggcattattcttccgt
cctgtcggcttagagtatcgtgctaaaattgataatccaacctggcgtacattatgggat
tggggattattcattggtggttttgtcccttcgctagttttcggtgtggcatttggtaac
ttgttacaaggtgtgccatttgaattcaacgaattattgcaagtcaaatacacagggtca
ttctttgcattattaaatccgtttgcgttactttgtggtttagtgagcttagcaatgtta
acaacacaaggtagtgcttggttgcaaatgaaaacaactagcgaattacgtcatcgtgct
cgtagcattacacaagctggtgccgttgctacaatcattacttttgtgcttgctggtgtt
tggttatatttcaaagacggttttgttgtgacatctgtgattgatcataacgccccatca
actccatttggtaaaactgtggcgattgaagcgggtgcatggtttaataactataaagac
atgccgattttatggattttccctttgctagcggtggtaagtgcagtattgaacatttta
gcctctaaagcagatcgttcaggtttcgcgtttttattctcatccttaacgatggcgggt
attattttgactgcgggcatttctatgttcccattcgtgatgccatccattacgcatcct
gaattaagcttattaatgtgggattctacatcaagtaaattgacattgaccttaatgctc
ggttttgcacttgtatttgttgtaattttacttgcatacacgatttgggcgtattggaaa
atgtttggtcgtctcgatagtcaatttatcgaagagaacaaaaactcattatactaa

DBGET integrated database retrieval system