KEGG   Pasteurella multocida 36950: Pmu_01980Help
Entry
Pmu_01980         CDS       T01729                                 

Gene name
tolQ
Definition
(GenBank) protein TolQ
  KO
K03562  
biopolymer transport protein TolQ
Organism
pmp  Pasteurella multocida 36950
Pathway
Microbial metabolism in diverse environments
Brite
Transporters [BR:pmp02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pmu_01980 (tolQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
205631..206320
Genome map
AA seq 229 aa AA seqDB search
MTADLNFLELFLKASIVVQFVIVILIIFSIMSWAIIIQRSRILTKALKDSAAFEDRFWSG
EDLNRLFDGLENKRDGLSGSEQIFYVGFKEFSRLKQANPNAPEAIIQGSSRAMNLAMNRE
VEELETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATA
IGLFAAIPAVMAYNRLSLRVSKLEQNYGNFIDEFTTILHRQAFGKNGTH
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagatttgaactttttagaattatttctaaaagccagtatcgttgttcaattt
gttattgtaattttaataattttctcaattatgtcttgggcaattattattcaacgtagt
cgtattttaacaaaggcattgaaagattcagctgcctttgaagatcgtttttggtctggt
gaagatttaaaccgtctatttgatggtttagaaaataagcgtgatgggttgagcggaagt
gaacaaattttttatgttggtttcaaagagttttcgcgtttaaaacaagctaatcctaat
gcaccagaggctattattcaagggagctcacgagcaatgaacttggccatgaatcgtgaa
gtggaagaacttgagacgcgcgtgccatttttagcaacggtggcatctattagcccatat
attggtttatttggcacagtctgggggatcatgcatgcatttatggcattgagtggtgct
aagcaagccacattacaaatggttgcccctggtatcgcagaagcattaattgcaacggcg
attggtttatttgcagcaattcctgcggtgatggcctataaccgtttaagtttacgtgtc
agtaaattagaacagaattacggtaattttattgatgaatttaccacaattttacaccgc
caagcatttggtaaaaatggtacacactaa

DBGET integrated database retrieval system