KEGG   Pasteurella multocida 36950: Pmu_02260Help
Entry
Pmu_02260         CDS       T01729                                 

Gene name
ychM
Definition
(GenBank) sulfate transporter YchM
  KO
K03321  
sulfate permease, SulP family
Organism
pmp  Pasteurella multocida 36950
Brite
Transporters [BR:pmp02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Pmu_02260 (ychM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
228639..230378
Genome map
AA seq 579 aa AA seqDB search
MLKKWFLSKNVFLAVKPFSALKESFRAGYTRQSLIRDIIAGLTIGVIAIPLSMALAIASG
VAPQHGLYTAIVAGMIIAVTGGSRFNVSGPTAAFVVILYPITQQFGLGGLLMATLLSGLI
LVLMALFRLGRLIEYIPLPVTLGFTCGIGIVIATLQIKDFLGLSILEMPAHYLEKVQTIV
TALPTINWADALVGIVTLLMLTQWHKLRLPIPGHLPAVIIATLLSLGLISVGQDVATIGS
AFQYTLSDGTQGFGIPNALPEFILPWHIPNAQGEVITWNLETIQALLPAAFSMAVLGAIE
SLLCAVILDNMTDTKHHSNNELLAQGLGNIAAPFLGGITATAAIARSVANVKAGGVSPIS
SVVHALLVLFALLFFANALSYLPLSSMAALLLVVAWNMANVPQIIQLIRRSGRNEIAVLL
TCLILTVIFDMVIAITVGVLLASLLFIRTIAEMTKSIEIAHPEDLNDVLVYRISGPLFFA
AADNLFADLHDKTVNTEHEIKHIVLQCDAVTVLDTGGIHALTRFVQHMLPHQQLYMCNMQ
FQPLRMIVKSNTVNEIQKINFASDLSDAFNKIRVFEQQA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaaatggtttctcagcaaaaatgtgttcttagccgttaagccttttagtgcg
ttaaaagagagttttcgcgcaggttacacgcgtcaatctttaattagagatattatcgcc
ggtttaactattggggtgattgcaattcctttgtcaatggcactggcgattgccagtggc
gtagcgcctcaacatggtttatatacagcgattgtcgcagggatgattatagcggtaaca
gggggatcgcgttttaatgtttctggtcccacggcggcatttgtagtgattttgtacccg
attacgcaacagtttggtttgggtggcttgttaatggccacgttgttatcgggcttgatt
ttagttctcatggctttgttccgcttaggacgtctcatcgaatacattcctttgcccgtt
accctaggttttacctgtggaattggtatcgtcattgccacgttacaaattaaagatttt
ttagggctatctattttggaaatgcctgcgcattatcttgaaaaagtgcaaactattgtc
actgcattaccgacgatcaattgggctgatgctcttgttgggatcgtgaccttattgatg
ttaacgcaatggcataaattacgtttacctattccgggtcatttacctgctgtgattatt
gccacgttattgtctttaggcttaatttctgtaggtcaagatgttgccaccattggttca
gcctttcaatacactttatccgatggcacacaaggatttggtattccaaatgccttacct
gaatttatcttgccttggcatattccgaatgcacaaggggaagtgattacttggaattta
gagaccattcaagcgttattaccggcagcgttttctatggcagtattaggcgcaattgaa
tccttattatgtgcggtgattttagataatatgacagacacaaaacaccattctaataat
gaattattagcacaaggattagggaatattgccgcaccgtttttaggggggatcacagcg
acagcggcgattgcgcgttctgtcgcgaatgtaaaagcaggtggcgtgtcacctatttcc
agtgttgtacatgcattattggttctgtttgcgctcttgttttttgcaaatgcgttatct
tatttaccgctttcgtcgatggcagctttattgctcgttgtggcatggaatatggcaaat
gtaccccaaattattcagctcatccgccgctctggtcgtaatgaaatcgcggtgttatta
acgtgcttaattttaacagtcatttttgatatggtgattgcgattactgttggcgtctta
ttagcaagtttactgtttattcgtacaattgcagaaatgacaaagtcgattgaaattgcc
catcctgaagatttaaatgatgtgctagtttatcgtattagtggaccgttattttttgct
gcagcagataatttatttgccgatttacatgataaaaccgtcaataccgagcatgaaatt
aaacatattgtattgcaatgcgatgcggtcacggtgctcgatacgggaggtattcatgcg
ttgactcgttttgtacaacatatgttgccacatcaacagctttatatgtgtaatatgcaa
tttcaaccgctacgaatgattgtcaaatcgaatacggtaaatgaaattcagaaaattaat
tttgcttcggatttgtcagatgcttttaataaaatccgcgtttttgaacaacaagcataa

DBGET integrated database retrieval system