KEGG   Pasteurella multocida 36950: Pmu_02360Help
Entry
Pmu_02360         CDS       T01729                                 

Gene name
yhjA
Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmp  Pasteurella multocida 36950
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(238661..240067)
Genome map
AA seq 468 aa AA seqDB search
MRVKNLFFSVVAIAVASFLGTVGYVHIFDKEQSAKLLSQTPLSGQAQQVAKILYDNGCQY
CHSTNAELPFYAKFPVAESIMQEDIKKGTRVFLLNEILDGLKDPTKLSEVSLAKLEQVLI
NDEMPVAKFVHLHWGSRPDLEEKTTLLNWIREQRQNHFLPANTQGTDPTRLVQPIPDSVA
TDPLKVALGDMLYHDGRLSGDGTIQCHTCHQLKNGGVDGLDVSVGIDGLKGGINAPTVYN
SVFNILQFWDGRAKDLAEQAGGPPLNPVEMGSKNWEEIIAKFEQDEAFKAKFLAVYPAIN
EATITHAIAEFEKTLITPNSAFDRYLKGEQNALTAAQIRGYELFKQHKCDTCHVGVAMGG
QSFEYMGLFDDYFAARGTPITEADQGRFAHTQDPADMHKFKVPTLRNIALTAPYMHDART
SDLKEAVRIMLHYQSGKTLPTKDVEDISAFLESLTGEYQGKLLTKENQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaatctattcttttccgttgttgccattgcagtcgccagctttttaggc
acagttggttatgttcatatctttgataaagaacaatccgctaaactgctatcgcaaacg
ccactaagtgggcaagcacagcaagtggcaaaaatcttgtatgacaatggctgtcaatat
tgtcatagtactaatgcagagttgcctttctatgctaagtttccagtggcagaaagcatt
atgcaagaagatattaaaaaaggcacacgtgtctttttgttaaatgagattcttgatggg
ttaaaagatcctactaaattgtctgaagtcagcctcgctaaattagaacaagttctgatt
aatgatgaaatgcctgtcgcaaaatttgtgcatttacactggggatcacgtcctgattta
gaggaaaaaacaacgctattaaattggatacgtgagcaacgccagaatcattttctaccg
gcaaatacacaaggtacagacccaacgcgtttagtccaaccgattcctgatagtgtagca
acggatccactgaaagtcgcattgggtgacatgctataccacgatggacgtctttcaggt
gatggtacaatccaatgtcatacttgccatcagttgaaaaatggtggtgtagatggtcta
gatgtttctgtcggtattgatggtctcaagggaggaattaatgccccaacagtgtataac
tccgttttcaatattttacaattctgggatggacgagcaaaagatctcgctgaacaagcc
ggcggtcctcctctcaacccagttgaaatgggctctaagaattgggaagaaattatcgct
aaattcgaacaagatgaagcatttaaagccaagttcttagccgtttatcctgcgattaat
gaagccacaattacacacgccattgcggaatttgaaaaaacattgatcacaccaaacagc
gcatttgaccgttatttgaaaggcgaacaaaatgcactcacagccgcacaaatacgtggt
tatgagctcttcaaacagcacaaatgcgatacttgccatgttggcgtcgcaatgggtggg
caatcctttgaatacatgggcttatttgatgattactttgccgccagaggcacaccgata
acagaagctgatcaaggacgctttgcacatacccaagatcctgctgatatgcataaattt
aaggtaccgactctacgtaatattgctctgactgcaccatatatgcacgatgctcgcaca
tcggatctcaaagaagccgtgcgtattatgttacattatcaaagtggtaaaacgttaccg
accaaagatgtagaagatatcagtgcattcttagaatcactcaccggtgaatatcaaggc
aagttattaaccaaagaaaatcagtaa

DBGET integrated database retrieval system