KEGG   Pasteurella multocida 36950: Pmu_02400Help
Entry
Pmu_02400         CDS       T01729                                 

Definition
(GenBank) putative membrane protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0126
Motif
Other DBs
NCBI-ProteinID: AET15184
Position
complement(244497..245177)
Genome map
AA seq 226 aa AA seqDB search
MLLSVLYIIGITAEAITGALAAGREKMDIFGVIIIAAMTAIGGGSVRDVLLGHYPIGWVK
NPHYFLIVAGAAVLTVFIVPLIRRFMHYFHTVFLVLDALGLIVFSIIGAQVALDMGYGFT
IAVIAAIITGAFGGVLRDLLCNRIPLVFQKELYASIALIATAIYIGLQQLNIDHNLVIII
TLISGFIARLLAIYFEWGLPVFDYQEQEMAKKNNDDKLPKKVTWKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaagcgtcctctacattattggtatcaccgcagaagccattacaggtgctctg
gctgctggacgtgaaaaaatggatatttttggcgtaattattattgctgcaatgacggcg
attggtggtggctcagtcagagatgtcttactcggtcactaccctatcggctgggtgaaa
aatccccattactttctgattgtggcaggtgcagcggtattaaccgtctttattgtgcct
ctaattcgtcgctttatgcactattttcataccgtcttcttggtcttagatgcccttggt
ttgatcgtgttttccattatcggtgcacaagttgcactggacatgggctatggctttact
atcgctgtgattgccgccatcattactggtgcgtttggaggggtactccgtgatttatta
tgtaaccgtattccactggttttccaaaaagagctgtatgccagtattgcattgattgcg
actgccatttatattggcttacagcaactcaatatcgatcacaatcttgttattattatc
accttgatcagtggctttattgctcgtcttttagcaatttatttcgagtgggggctgcct
gtttttgactatcaagagcaagaaatggcaaagaagaataatgatgacaaattacccaaa
aaagtaacatggaaaaaataa

DBGET integrated database retrieval system