KEGG   Pasteurella multocida 36950: Pmu_02410Help
Entry
Pmu_02410         CDS       T01729                                 

Definition
(GenBank) putative membrane protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AET15185
Position
245315..246124
Genome map
AA seq 269 aa AA seqDB search
MSEEKTSPILTALFSLFPILLLLSTDIFTLFLSSQAKAISHLAFAVLIAQLCCILVFTKG
QICPGQRGRLSQVNLYFVIFWGIWLLLSLFSNYHFILTDMLSLCGIAVAIAIWQQPEEAK
LRRSMLFIASLIGGVGCLCYCLMFIEIPPRYWGQYSLFAQVLVGIILANLALVISRNRLQ
GFIGLLPFLMLIALLLNAISVLSLLLYFSSAVYFVNQLAFVLYFVLHLVIAMFIAVHIFK
KWVFSYTTLSILLFMSASLPLWASFAFIQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagaaaaaacatcgccgattttgaccgcacttttctcgctttttccgatactg
ttattgctcagtaccgatatttttacactgtttctgtcttcacaagccaaggcaatttcg
catctcgcttttgctgtcttaattgcacaattgtgttgcattttggtcttcacaaaagga
caaatttgtcccggacaacgggggcgtttaagccaagtgaatctttattttgtcattttt
tggggtatttggcttttattaagtcttttttctaactaccattttattttgactgatatg
ttgagcttatgtggtattgccgttgctatcgcgatttggcaacagcctgaggaagcgaag
ttacgtcgttccatgctttttatcgcgagcttaataggtggcgttggctgtctttgctat
tgcttgatgtttattgagattccgccacgttattggggacaatatagtctgtttgcgcaa
gtattagtcgggattattttggcgaaccttgctttagtgatttcacgtaatcgtttacaa
gggtttattggattattgcctttcttgatgctgattgcgttgttactgaatgcgatcagt
gtgttgagcttgctactgtatttttcaagtgccgtgtattttgtcaatcagctagcattc
gtgttgtattttgtattgcatttagtgatcgctatgtttatcgcggtgcatatctttaaa
aaatgggtattttcttatacaacgctgagcattttattatttatgtccgcttcattgcca
ctttgggctagctttgcttttattcaataa

DBGET integrated database retrieval system