KEGG   Pasteurella multocida 36950: Pmu_02430Help
Entry
Pmu_02430         CDS       T01729                                 

Gene name
cpg2
Definition
(GenBank) carboxypeptidase G2
  KO
K01295  glutamate carboxypeptidase [EC:3.4.17.11]
Organism
pmp  Pasteurella multocida 36950
Brite
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.11  glutamate carboxypeptidase
     Pmu_02430 (cpg2)
Peptidases [BR:pmp01002]
 Metallo Peptidases
  Family M20
   Pmu_02430 (cpg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AET15187
Position
complement(247591..248730)
Genome map
AA seq 379 aa AA seqDB search
MILNAFLKDLESLVNIDSYSYDPVGKARVVQFFKEKFQSIGWLVEERFLDEKVGSALICK
NTPSDTFDVVLSGHMDTVFKTGTVNERPFRIEQDKAFGPGIADMKAGLLAGFYACKQLTE
ENALQDAKVCVLFNPDEEISSIFSRPLLEEYAKKTRYAIILEAARINGNLVNERKGIGKY
VIEFFGKSAHAAVDPQNGANAINAFIRIAQDLLKSTAPDKGTTMNIGTVEGGTTPNTVPD
YVKTQIDCRFTCLEESQRLNQLIYALNDTVTEERVKIKVTGGITRPPWRRTEAGLQFCAA
VDKIKEKLGIQAEWESTAGGSDGNFFAALGVTVIDGMGPSGGKWHSPDEYLNIDSIEPRV
KLVSEVIKYCTQHKGDTSC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaatgcctttctgaaagatctagaatctctcgtcaatattgatagctatagc
tatgatcctgttggtaaagcacgtgttgtccaattttttaaagaaaaattccagtccatt
ggttggcttgtagaagaacgttttcttgatgaaaaagtgggctctgcgctgatttgtaaa
aatacgccttctgatacatttgatgtggttttatcaggacatatggataccgtgtttaaa
actggaacagtcaatgaacgcccatttagaattgagcaagataaagcttttggaccggga
attgctgatatgaaagccggtctcttagctggattttacgcttgtaaacagttaaccgaa
gaaaatgcactacaagatgcaaaagtctgtgtgcttttcaatcccgatgaagaaattagt
tctatcttctctcgcccattgttagaggagtatgcgaaaaaaacacgctatgccattatt
ctagaagccgccagaattaacggtaacctagtcaacgaaagaaaagggattgggaagtat
gtaattgaattttttggcaaatctgctcatgcggcagtcgatccacaaaacggagcaaat
gccatcaatgcgtttattcgtatcgcgcaagatttactaaaaagtaccgcgcccgacaaa
ggtaccacgatgaacattggtactgtggaaggagggaccacgccaaatactgtacctgac
tatgtcaaaacacaaattgattgtcgctttacttgtcttgaggaaagtcaacgactcaat
caacttatttacgccctaaatgacacggtgaccgaagaacgcgtcaaaatcaaagtgaca
gggggtattactcgtccaccttggcgacgtactgaagccggtcttcaattctgcgccgcc
gtcgataaaatcaaagaaaaactcggcatacaagctgaatgggaatctactgccggtggt
tctgatgggaatttctttgcagcactcggtgtcactgtcattgatggtatgggaccaagc
ggtggaaaatggcacagtcctgatgaatacttaaatatcgactccatcgaaccgagagtc
aaactcgtatctgaagtcataaaatattgtactcaacataaaggagacacgtcatgctag

DBGET integrated database retrieval system