KEGG   Pasteurella multocida 36950: Pmu_02520Help
Entry
Pmu_02520         CDS       T01729                                 

Definition
(GenBank) putative entericidin protein
  KO
K16348  entericidin B
Organism
pmp  Pasteurella multocida 36950
Brite
Transporters [BR:pmp02000]
 Other Transporters
  Others
   Pmu_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Entericidin
Motif
Other DBs
NCBI-ProteinID: AET15195
Position
257857..257988
Genome map
AA seq 43 aa AA seqDB search
MKKIIAIFLSATFAFALTACETTKGVGKDIQNAGEKLEQAVSK
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattgctattttcttatctgcgacatttgctttcgctttaactgcttgt
gaaaccacgaaaggtgtcggtaaagatattcaaaacgcgggtgaaaaattagagcaggct
gtaagtaaatag

DBGET integrated database retrieval system