KEGG   Pasteurella multocida 36950: Pmu_02550Help
Entry
Pmu_02550         CDS       T01729                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmp  Pasteurella multocida 36950
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pmu_02550 (gmk)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pmu_02550 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
259909..260535
Genome map
AA seq 208 aa AA seqDB search
MTQGNLYILSAPSGAGKSSLISALLNQQQDNKMMVSVSHTTRQPRPGEQEGVHYYFVSVE
AFESLIEQDLFLEYAKVFGGNYYGTSLPAIEENLAKGIDVFLDIDWQGAQQIRQKVPNVK
SIFILPPSLAELERRLIGRGQDSTEVIAARMSKAIDEISHYNEYDYVIVNDVFEQALADF
QAILRAERLTLAHQQKQNQALIEQLLAK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggtaatttatatattctttcggcacccagtggcgcggggaaatcctcatta
atttccgcattattaaatcagcaacaagacaataaaatgatggtttctgtttcacataca
acaagacaaccccgtcccggtgagcaagagggagtgcattattattttgtatcagttgaa
gcctttgaatcattgattgagcaagatttatttcttgagtatgccaaggtttttggcgga
aattattacggcacttcattacctgctatcgaagaaaatttagccaaaggtattgatgtt
tttttagatattgattggcagggtgcgcagcaaattcgtcaaaaagtgccgaatgtcaaa
agtatttttattttacccccgtctttagctgaattagaacgtcgtttaattggacgtggg
caagacagtacggaagtgattgccgcacgtatgtcgaaagcaatcgatgaaatttctcat
tataatgaatacgattatgtgattgtaaatgatgtctttgaacaagcattagctgatttt
caagcgattctacgtgctgaacgtttaacgttagcgcatcagcaaaaacaaaatcaggcg
ttgattgaacaattgctagcaaaatag

DBGET integrated database retrieval system