KEGG   Pasteurella multocida 36950: Pmu_02660Help
Entry
Pmu_02660         CDS       T01729                                 

Definition
(GenBank) putative lipoprotein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(272295..272966)
Genome map
AA seq 223 aa AA seqDB search
MKKTLVLSCCIVALCACKAEIEKDISLKALLNEPIKVESGILNVEIATCSSHEDSRKPSD
ALIQIQQKIPNVFDNAVYKECYQKNFNSFASFEIPIAVGKLDDSSEIKHNVNIYSYKNHY
LNVQTSDKLAKNIRDFMDREYLSDLALSLTLKINNDTNQALDVTFISAYVNDSPVDFLPL
TFKQGESIEVKLSNASSDMLWQYEASPSVSVMTKGFELDDILK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgcttgtactttcttgttgcatcgttgcgttatgtgcatgtaaagcagaa
atagaaaaagatatctcattaaaagccttattgaatgagccaattaaagtagaaagtggt
atcttaaatgttgaaattgcaacatgttctagccatgaagactctagaaagccctccgat
gcccttattcaaattcaacaaaaaattcctaatgtttttgataatgctgtttataaagaa
tgctatcaaaaaaactttaattcttttgcaagttttgaaatccctattgctgtggggaaa
ttggatgatagctcagagataaaacataacgtaaatatttatagctataaaaatcactat
ttaaatgttcaaacaagcgataaattagcaaaaaatatccgtgactttatggatagagaa
tatctctctgacctcgcattaagcctaacactcaagataaataatgatacaaatcaagct
ctggatgtcaccttcatttccgcctatgtgaatgattcccctgttgatttcttacccctc
acctttaaacaaggggaaagtattgaagtgaaattgtctaatgcttcatcagatatgctc
tggcaatatgaagcatcaccaagtgtaagtgtgatgacaaaaggctttgagcttgatgac
attctaaaataa

DBGET integrated database retrieval system