KEGG   Pasteurella multocida 36950: Pmu_02680Help
Entry
Pmu_02680         CDS       T01729                                 

Definition
(GenBank) hypothetical protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AET15205
Position
273706..274284
Genome map
AA seq 192 aa AA seqDB search
MKEANMTNKFTGYKKLSINDLKKFEYNLEHIRNAAIFFKDHFLSKEMIYSTEKESTSVIF
QRSNFMHLCGIYYEPGASEFFNLALLKQIDLNKVYIKNDGTTFQKLSVLSSIDFLINPEI
TLSSGAIYLNLSFDKALRTKTRVFALTLINDNHLFIPQSLLNLRTMNDFPKGNKIIGIKS
VHLEDKTEIIYL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcaaatatgactaataaatttactggatacaaaaaactaagcattaatgac
ttgaaaaaatttgagtataatttagagcatataagaaatgccgcaatctttttcaaagat
cattttcttagtaaagaaatgatatatagtactgaaaaagaaagtacatccgttatcttt
caaagaagcaattttatgcacttgtgcggaatatattatgaacccggtgcgagtgaattt
tttaatcttgccttattaaaacaaatagacctaaataaggtttatataaaaaatgatggc
acaacattccaaaagttgtctgttttaagttctatagattttttaattaatccagagata
actttgtcatcaggtgcaatttatttaaacctttcttttgataaagctcttagaactaaa
accagagtctttgctctcacattgataaatgacaatcacttatttattccacaatcttta
ctgaatcttaggaccatgaatgatttccctaagggtaacaaaattattggtataaaatca
gttcatttagaagataaaacagaaatcatctacttatag

DBGET integrated database retrieval system