KEGG   Pasteurella multocida 36950: Pmu_02700Help
Entry
Pmu_02700         CDS       T01729                                 

Definition
(GenBank) tyrosine recombinase-1 family protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_5 Phage_int_SAM_4 Phage_int_SAM_1 Ku_PK_bind PepX_N
Motif
Other DBs
NCBI-ProteinID: AET15207
Position
275603..276502
Genome map
AA seq 299 aa AA seqDB search
MSFEQLLHLFFLERNHRPATIRSYQNVIAQIVKFYPDKEPEQISKLDLLEWRKYCLNKMS
PITWNSYIRHLKAIFNYAIDNELFEYPKNLFKGLMVRPDKPKKKLLTERQIHFLEISLEN
EEKLPHYLQPAYFTKALIYTLKYTAIRQSQLLQLKISDIDMTSKIINIRAETNKNHEHHE
IPISDKLYPYLKRLILESRARSTSSDEQLFNINRFSLVTTSRNKKMTEGQLVHFFRHISE
FIGFTVTSHRFRHTTATEVLKQSGDIYAVKQLLGHKDLTVTLTYIHNDPEMLRKHVNSL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaacaattattgcatttatttttcttagaacggaatcatagacctgccact
atacgttcttatcaaaatgtaatagcgcagattgttaaattttatccagataaagaacct
gaacaaatatctaagcttgacttattagaatggagaaagtattgcctcaataaaatgagc
ccaattacttggaatagttatatcagacatcttaaagctatttttaattatgctatagat
aatgagctatttgagtaccctaaaaatttatttaaaggccttatggtaagacctgataag
ccaaagaaaaaactactaacagaaaggcaaatccattttttagaaatctctttggaaaat
gaggagaaattacctcattatttacaacctgcttattttactaaagctttaatctacact
ttaaaatatacagctatcagacaatcccagctattacagctaaaaatttctgatatcgat
atgacaagcaaaattataaatataagagctgaaaccaataagaatcatgaacaccatgaa
attccaatttcagataaattatatccatacctaaaaagattgatattagaatcaagagct
agaagcactagttcagatgagcagttatttaacattaatcgcttttcattagttactaca
tcaagaaataagaaaatgacagaaggacaactagttcatttttttcgccatatttctgaa
tttataggatttacagtaacttcacatcgattccgacatacaactgcaacagaagtccta
aagcaatcaggggatatctatgcagtgaagcaattacttggacataaagatctcactgta
actctaacatatattcacaatgatcctgaaatgctaagaaaacatgtcaattcgttgtag

DBGET integrated database retrieval system