KEGG   Pasteurella multocida 36950: Pmu_02770Help
Entry
Pmu_02770         CDS       T01729                                 

Gene name
strA
Definition
(GenBank) aminoglycoside 3''-phosphotransferase protein
  KO
K10673  
streptomycin 3"-kinase [EC:2.7.1.87]
Organism
pmp  Pasteurella multocida 36950
Module
Streptomycin resistance, deactivating enzyme StrAB
Brite
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.87  streptomycin 3''-kinase
     Pmu_02770 (strA)
Antimicrobial resistance genes [BR:pmp01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    Pmu_02770 (strA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(281764..282522)
Genome map
AA seq 252 aa AA seqDB search
MPVRGGESGDFVFRRGDGHAFAKIAPASRRGELAGERDRLIWLKGRGVACPEVINWQEEQ
EGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVD
VVSRNAVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPK
TLQCTGLIDLGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERL
AFYLRLDPLTWG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgtcagaggcggagaatccggtgattttgtttttcgacgtggtgacgggcatgcc
ttcgcgaaaatcgcacctgcttcccgccgcggtgagctcgctggagagcgtgaccgcctc
atttggctcaaaggtcgaggtgtggcttgccccgaggtgatcaactggcaggaggaacag
gagggtgcatgcttggtgataacggcaattccgggagtaccggcggctgatctgtctgga
gcggatttgctcaaagcgtggccgtcaatggggcagcaacttggcgctgttcacagccta
tcggttgatcaatgtccgtttgagcgcaggctgtcgcgaatgttcggacgcgccgttgat
gtggtgtcccgcaatgccgtcaatcccgacttcttaccggacgaggacaagagtacgccg
cagctcgatcttttggctcgtgtcgaacgagagctaccggtgcggctcgaccaagagcgc
accgatatggttgtttgccatggtgatccctgcatgccgaacttcatggtggaccctaaa
actcttcaatgcacgggtctgatcgaccttgggcggctcggaacagcagatcgctatgcc
gatttggcactcatgattgctaacgccgaagagaactgggcagcgccagatgaagcagag
cgcgccttcgctgtcctattcaatgtattggggatcgaagcccccgaccgcgaacgcctt
gccttctatctgcgattggaccctctgacttggggttga

DBGET integrated database retrieval system