KEGG   Pasteurella multocida 36950: Pmu_02830Help
Entry
Pmu_02830         CDS       T01729                                 

Definition
(GenBank) putative LysR transcriptional regulator, HTH domain profile
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 HTH_24 HTH_AsnC-type HTH_30 MarR_2 HTH_28 HTH_Tnp_4 HTH_20 HTH_34 HTH_37 MarR P22_Cro HTH_23 Mga
Motif
Other DBs
NCBI-ProteinID: AET15215
Position
288066..288371
Genome map
AA seq 101 aa AA seqDB search
MRRTNHRNLVNVGILSGRIPLISLVQFIAVAEHLNFRHAAKALGISQSSVSARVKALEDN
LGVLLFERHARGVRLTDAGRHFMERVTAGVDQLDHAVKTAE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcactaaccatcgaaacctcgtgaatgtcggtatcctgtctggcaggataccg
ctcatttcccttgttcagttcatcgccgtcgccgagcatctgaattttcggcatgcggcc
aaggcacttggtatcagccagtcgagcgtcagcgcgcgtgtgaaagcgctggaggataac
cttggtgtcctgctatttgagcgccatgcgcggggcgttcggctaacagacgcaggcagg
cacttcatggagcgtgtcacggcgggtgtcgatcaactcgatcacgcagtgaagaccgcg
gagtga

DBGET integrated database retrieval system