KEGG   Pasteurella multocida 36950: Pmu_02880Help
Entry
Pmu_02880         CDS       T01729                                 

Definition
(GenBank) tyrosine recombinase-2 family protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(292568..293332)
Genome map
AA seq 254 aa AA seqDB search
MLIEWRNQIVGDKIKAVTWNNYVRHLKSLYNFGLSQGVLNINQNPFNQLFIRESKRRKKT
YSTEQLHKIDHILNNNILLPDFLKPSWFILAIIMTLRCTGIRRGQLVKLKIGDVNLSNRT
IYISPEINKNHDYHIVPISDSLYLHIERLITELKIRKQTDNCQLFNLNLFSRCSRRRGQP
MSQNQLTHIFRHISDLVGFTSSPHRFRHTVATQLMKKPENVYVVQKLLGHKDISVTLGYI
EHDVEMLRETVNLL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgaatggcgtaatcaaattgttggcgataaaatcaaagctgtaacatggaat
aattatgtcagacatttaaaatcgttatataactttggtctatcgcaaggggtactcaat
ataaatcaaaatccatttaatcagttatttattcgtgaatcaaaaagaagaaagaaaact
tattcaaccgaacaattacataaaatagaccacatactcaataataacattctattacct
gattttctaaaaccaagttggtttattcttgcgattattatgacattgagatgtacaggc
attcggcgaggacaattagtgaaactgaaaattggtgatgtaaatctttccaacaggacg
atttatatttcgccagaaatcaataaaaatcatgattaccatatcgtaccgatttcagat
tcactttatcttcatatagaaaggcttattacagagttaaaaatcagaaaacaaacagat
aattgccaattgttcaatctcaatttattttctcgatgctctcgaagaagaggacagcca
atgagccaaaatcagcttacgcatatatttcggcatatttctgacttggtcggttttact
tcatcaccacatagatttcgacatacggttgcaactcaattaatgaagaagcccgaaaat
gtttatgtggttcagaaacttctagggcataaggatatcagcgtaacactaggttatatt
gagcacgatgtggaaatgttgagagagacagtgaatttactctga

DBGET integrated database retrieval system