KEGG   Pasteurella multocida 36950: Pmu_02910Help
Entry
Pmu_02910         CDS       T01729                                 

Definition
(GenBank) hypothetical protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AET15221
Position
complement(296765..297511)
Genome map
AA seq 248 aa AA seqDB search
MPNWCENKLQIFCDCIQAKQIIPKLFRKTESDKWCLDFELLVPMPESICIESSSLGDRAM
EFLKISPNRRLTRPLLKKYIYGSEIDRIYAKAKHHRWDVGHFINWLIKRPEQQSILWLNL
ALGQQYLSNLAQHGYKDWYDWSNEQWGCKWNVCSDSCQVSFNDNGSINCLFDTPWGPPDG
WFQALCTAFPDIEFILSFFEPGMWFAGKYIANLDGSYCNIYIDDRGIRSFAEEVFNEEFE
DEFEEKLE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactggtgtgaaaataaactacaaattttttgcgattgtatccaagctaaacaa
attattcctaagcttttcagaaaaactgaaagtgataaatggtgtttagactttgaatta
ctcgttccaatgccagaatcaatctgcattgaatcaagtagtcttggtgatagagcaatg
gaatttctaaaaatttcaccaaatagacgtttaacacgccctctactcaaaaagtatatc
tatgggtccgaaattgatcggatatatgctaaggcaaagcatcatcgctgggatgtaggt
cattttatcaactggttgataaaacgtcctgaacaacaaagtatattatggctaaacctc
gcattaggccagcaatatctgtctaacctagctcaacatggttacaaagattggtatgac
tggtcaaatgaacagtggggctgtaaatggaatgtatgttcagatagctgtcaagttagc
tttaatgataatggatctattaattgcctatttgatacgccatggggaccacctgatggt
tggttccaagcactttgtactgcctttcctgacattgagtttatactttcattttttgag
ccgggaatgtggtttgcgggcaaatatatcgcaaatcttgatggctcatactgcaatatt
tacatagatgataggggtattcgcagttttgctgaggaagtctttaatgaagaatttgaa
gatgagttcgaagagaaacttgaatag

DBGET integrated database retrieval system