KEGG   Pasteurella multocida 36950: Pmu_02940Help
Entry
Pmu_02940         CDS       T01729                                 

Definition
(GenBank) hypothetical protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(299393..300235)
Genome map
AA seq 280 aa AA seqDB search
MSGSVLNTYFKHALVKAGFPNCLNIEYSLSHCQGDGVAFYGRLNTETLINLFNKLNPQKR
TQKMFSNLLNHIESWEPHYGVDFEIIRNSFGYRYSHCNTMELSVRTADDLAFFYDRDARK
EWYFPTSKVEKYKALWDGFIQDLGQYIKDTSCALESNGYQIIEASPYQTETIFKFNTENY
LIELKRKSSEFYSESVDWLCGDVCDFEAMIEEILQGKLCYADFVATVTDKESGIQLGSDE
ITGVSYSPTDHSLSGYRQELISNAIASARSNAARFAYLHA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctcagtcttaaacacttattttaaacacgctcttgttaaagctggttttcct
aattgcttaaacattgagtattcactttctcattgtcaaggcgatggcgtagcattctac
ggtaggcttaatacggagacgttaattaatcttttcaacaagctaaatcctcagaaacgc
acacaaaaaatgttttctaatctgctgaatcacattgaatcttgggagcctcactatggc
gtggattttgaaatcatacgaaatagttttgggtaccgctattcgcattgtaatacgatg
gagctttctgttagaacagcagatgatttggcatttttctatgatcgtgatgcccgaaaa
gagtggtatttccctacatcaaaagtggaaaaatacaaagccctgtgggatggatttatt
caagatttaggtcagtatattaaagatacttcctgtgccttagaatcgaatggctatcag
attattgaggcctcaccgtatcagacggaaactattttcaaatttaacacggaaaactat
ctgatagaacttaaacgtaaatcctctgaattttattcagagtctgttgattggctatgt
ggtgatgtctgcgattttgaggcaatgatagaggaaatcctacaagggaaactttgctat
gctgattttgtagcaaccgttactgataaggaaagtggcattcaactaggtagcgatgaa
attacaggcgtaagctattcgccgacagaccattcattgagtggttatcgacaagagctt
attagtaatgctatagcttctgctcgtagtaatgccgcacgttttgcctacttgcatgcc
tga

DBGET integrated database retrieval system