KEGG   Pasteurella multocida 36950: Pmu_05790Help
Entry
Pmu_05790         CDS       T01729                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmp  Pasteurella multocida 36950
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pmu_05790 (recD)
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pmu_05790 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
590176..592149
Genome map
AA seq 657 aa AA seqDB search
MLATLKELKQHKVISEGDYYFAQLIAGKQPDELSREQKNLAILLAALCSYSYQQGNTCLF
LEKGLESNYFNLAYRTAEQHYLHIIQEKIAFLPIECWQSSLADHIAFTATPLEKVAPLVF
QFNALYFYRIWQDEYRVAHYLQRAVQRGAETAPIAYEQINAILMHYFPAVQQIEGVNWQK
VAVATALKQPFCLITGGPGTGKTTTVARLLLALQTLSACQLKIKLVAPTGKAAARLTESI
NGALTRLAQENMAICADLIASIPTTAQTLHRLLGIRFFEETPTFHPNNPLPLDVLVVDEA
SMIDLPLMAKLLQALKPNTKLILLGDENQLSPVEAGEMLGALSEFSQHAYSPTLTQYLKA
VADIELISSDQGSPLRDHLCRLHHSHRFSGDSGIGQLAQAINQGNVEVSWNAFTHFNDIE
MVDFDQVALLKGDNPSLYSQACAALVVKSAVEKYTDYLVKLKALQQQSPILNEQQVGEIF
VLFNAVRFLTALRVGELGVEQLNQKIAQRLQQKGLLDFKHERDWYLGKPIMIQQNDRHIG
LYNGDIGLFLGQGKVWFEQGQGHYKTVLASRVPNYETAFVMTVHKSQGSEFAHTCLVLPT
EPNPILSRELIYTGVTRAKQQLTVFSSAEIWKSAVKNPVKRQSGLNQLLVELFNKSD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctaccttaaaagaattaaaacaacacaaggtgatcagtgaaggagattactac
tttgcgcaattgatcgcgggtaagcaaccagatgaactgtcgcgggaacagaaaaattta
gccatattgcttgccgcactttgtagttacagctatcaacaaggcaatacttgcttattt
ctagagaaagggctggaatctaattattttaatttggcttatcgaacagcagagcagcat
tatctccatattattcaagaaaaaattgcttttctaccgattgaatgttggcaatcaagc
ttggcggatcatatagcgtttacagcaacgccgctggaaaaagtcgcccctttagtgttt
cagtttaatgcgctttatttttatcgtatctggcaagatgaataccgagttgctcattat
cttcaacgtgcagtacagcggggggctgagacagcgcctattgcttatgagcaaatcaac
gcgatcttaatgcactattttcctgcggtacagcaaatagaaggggtgaattggcaaaaa
gtagcagtagcgaccgcgttaaaacaaccattttgtttgattacaggtggtccaggaaca
gggaaaaccactactgtcgcacgtttactcttggcgttacagacactttctgcgtgtcag
cttaagattaagttagttgcacctacaggcaaagcggcagcacgcttgacggagtcaatt
aatggtgcgttaacgcgtttagcacaagaaaatatggcgatctgtgccgatttaattgcc
tctattccgactacagcgcagaccttacatcgtttattgggcatacgtttttttgaagaa
acacccacctttcatccaaacaatccattgccattggatgtattggtggtcgatgaggcg
tctatgattgacttgccattaatggcgaaattattacaggcactcaaaccgaataccaaa
ttaattttgcttggagatgaaaatcaattgtctcctgtggaagcaggggaaatgttggga
gcgttgtctgaattttctcaacacgcctatagtcctacgttaacccagtatttaaaagca
gtggcggatattgagttaatttcgtcagatcaaggttccccgttgcgtgatcatttatgc
cgtttgcatcatagtcatcgtttttcgggggattctgggattggacaattagcgcaggcg
attaatcaaggcaatgttgaggtaagttggaacgcatttacccattttaatgatatcgaa
atggtggattttgatcaggttgccttattaaaaggagataacccgagtttatatagccaa
gcgtgtgcagcgttagtggtaaaaagtgcggttgaaaaatacacagattatttagtgaaa
ctgaaagcattacaacaacagtcacctatactgaatgaacaacaagttggagaaattttt
gtcttgtttaatgcggttcgtttcttaacagcattacgcgttggagagctaggggtagaa
cagctaaatcagaaaatcgcgcaacgcttacaacaaaaaggcttacttgattttaaacac
gaacgcgattggtatttaggtaaaccaattatgatccagcaaaatgatcgccatattggc
ttatataatggcgacattggcttatttttaggacaaggtaaagtctggtttgagcaggga
caagggcattataaaactgtgctcgctagccgtgtgccaaactatgagaccgcgtttgtg
atgacggtacataaatcacaagggtctgagtttgcgcacacgtgtttggtattaccgacc
gaacctaacccgattttatcacgtgaattgatttatacaggcgtgacacgtgcgaaacag
caattaaccgttttttcaagtgccgaaatttggaaaagtgcggtgaaaaatccagtaaaa
agacaaagtggcttgaaccaattgttagttgaattatttaacaaatctgattag

DBGET integrated database retrieval system