KEGG   Pasteurella multocida 36950: Pmu_06060Help
Entry
Pmu_06060         CDS       T01729                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmp  Pasteurella multocida 36950
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
616856..618949
Genome map
AA seq 697 aa AA seqDB search
MDIAYIRREAEKQGIAPSHYDINGNLIYASQETLTYFTDLLKSSSATSEAQLHFDDVVVF
LENEPIQYALTRLPVVNQTPLSCQIMDEAGKHILTQSCIERDVITLPALEFGYYHLRITY
ENHAYSVRLLISPKTAYQPPVLQQRKAWGLNVQLYSLRSKQNWGIGDFADLAYLVEQATK
YGVDFIGINPLHLMYSAVPEWASPYSSSSRRWLNPIYLSVTTLPEFKCCKSVQHWFASDE
IQDLLEQLQATELVDYAQVMWLKQNALEQLFAFSKRSQSTSIIQRRQAFLQFMQQQGEPL
LLQGLFEVLDRQSHSNMPTEKEIGWLGWRREWQQLSPAKRQTLLKTHQAEIEFYAWLQWL
ATEQLTDIQALCHRLGMNLGIYGDLAVNSSRGSADVWTDPELYFVNASVGAPPDPLGPVG
QNWNLPPYNPAILTRRGFQPFIDMLRSNMQHFGILRIDHVMGLFRLWLIPEEKSAADGVY
VHYPFDALMAILTIESQRNRCLIVGEDLGTVPDEVRSKLNQLHIFSYFVLYFEQRNRQYP
ASEQFPVKAFATIGTHDVPSLQSFWHCVDLQLFNQLGILDGEILQQKYEQRVIDKQALLD
TLHRDGYLPPHYEGNALSMAMHAHLNYVLHQYLARSCTQLIGVQLENVLSQEISFNLPGT
DREYPNWRKKLACTLEQMFSDKHITAFLSAIDQARHA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcatacatccggcgggaggctgaaaagcaaggcattgcgccctctcattat
gacattaatgggaatttgatttacgccagccaagagacgttaacttattttacggattta
ttgaaatcttcgtcagccacatcagaggcacaattacattttgatgatgttgtcgtgttt
cttgaaaatgaaccgattcagtatgcattaacgcgtcttcctgtggttaaccaaacgcca
ctgtcttgccaaatcatggatgaagcgggtaaacatattctgactcaatcctgtattgag
cgtgacgttatcaccttacctgcacttgagtttggttattatcatctgcggatcacttat
gaaaatcacgcttattctgtccgtttattgatcagtcctaaaacagcgtatcaaccccct
gtgttacagcaaagaaaagcatggggattgaacgttcaattatatagcttacgctcgaag
cagaattggggaattggggattttgcagacctagcgtatttagttgaacaggcgacgaag
tatggcgtggattttataggcattaatccgttgcatttgatgtatagtgcggtaccagaa
tgggcgagcccttatagctcatcttctcgtcgttggttgaaccctatttatttatctgtg
accacattgccagaatttaaatgctgtaaaagcgtgcagcattggtttgcttccgacgag
attcaagacttgcttgagcagttacaagcaacagaattagtggattatgcacaagttatg
tggttaaagcagaatgcacttgaacaattgtttgctttctcaaagcgcagtcaatcgact
tctatcattcaacgccgtcaagcctttttgcaattcatgcaacagcaaggtgaaccgtta
ttgttacaaggcttatttgaagtattagaccgtcaatcgcactcaaatatgccaacagaa
aaagagattggctggctaggttggcgtcgtgaatggcaacagttaagcccagcaaaacgc
caaacgttactcaaaacgcatcaagcagagattgagttttacgcttggttacaatggtta
gcgacagaacaattaacggatattcaagcattgtgtcatcgcctcggcatgaatttgggg
atttatggtgatttggcagttaatagttcacgcggtagtgcggatgtgtggactgatccc
gaattgtactttgtgaatgcctccgtaggggcgccgccggatcctttaggacccgttggg
caaaactggaacttacccccttataatcctgcgatcttaacccgccgtggttttcaacct
tttattgatatgttgcgcagtaatatgcagcattttgggatcttgcgtattgaccatgtg
atggggttattccgtttatggttgattcccgaagaaaaaagcgcagccgatggtgtgtat
gttcattatccctttgatgcgttaatggcgattttaacgatagaaagccaacgcaatcgt
tgcttgattgtaggggaagacttgggcactgtcccagatgaagtgcggtcaaaattaaat
cagttacacattttttcttactttgtcttatattttgagcaacgtaatcgtcaatatccc
gcaagtgaacaatttccagtgaaagcttttgctaccattggcacgcatgacgtaccgtcg
ttacaaagtttctggcactgtgttgatttacaactttttaatcaactcggcattctagac
ggtgagatcttgcaacaaaaatatgaacaacgcgtgattgataaacaagcattattggac
acgttgcatcgtgatggctatttgccccctcattatgaaggaaatgccttatcaatggcg
atgcatgctcatcttaactatgtgttacaccaatatttagccagaagttgtactcaattg
attggggtacaactggaaaatgtattaagccaagaaatttcatttaatttacccggtact
gatagggaatatccaaactggcgtaaaaagctcgcatgtacacttgaacaaatgtttagt
gataagcatatcaccgcgtttttaagcgcgattgatcaagctcgtcatgcatga

DBGET integrated database retrieval system