KEGG   Pasteurella multocida 36950: Pmu_06060Help
Entry
Pmu_06060         CDS       T01729                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmp  Pasteurella multocida 36950
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmu_06060 (malQ)
Enzymes [BR:pmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pmu_06060 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616856..618949
Genome map
AA seq 697 aa AA seqDB search
MDIAYIRREAEKQGIAPSHYDINGNLIYASQETLTYFTDLLKSSSATSEAQLHFDDVVVF
LENEPIQYALTRLPVVNQTPLSCQIMDEAGKHILTQSCIERDVITLPALEFGYYHLRITY
ENHAYSVRLLISPKTAYQPPVLQQRKAWGLNVQLYSLRSKQNWGIGDFADLAYLVEQATK
YGVDFIGINPLHLMYSAVPEWASPYSSSSRRWLNPIYLSVTTLPEFKCCKSVQHWFASDE
IQDLLEQLQATELVDYAQVMWLKQNALEQLFAFSKRSQSTSIIQRRQAFLQFMQQQGEPL
LLQGLFEVLDRQSHSNMPTEKEIGWLGWRREWQQLSPAKRQTLLKTHQAEIEFYAWLQWL
ATEQLTDIQALCHRLGMNLGIYGDLAVNSSRGSADVWTDPELYFVNASVGAPPDPLGPVG
QNWNLPPYNPAILTRRGFQPFIDMLRSNMQHFGILRIDHVMGLFRLWLIPEEKSAADGVY
VHYPFDALMAILTIESQRNRCLIVGEDLGTVPDEVRSKLNQLHIFSYFVLYFEQRNRQYP
ASEQFPVKAFATIGTHDVPSLQSFWHCVDLQLFNQLGILDGEILQQKYEQRVIDKQALLD
TLHRDGYLPPHYEGNALSMAMHAHLNYVLHQYLARSCTQLIGVQLENVLSQEISFNLPGT
DREYPNWRKKLACTLEQMFSDKHITAFLSAIDQARHA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcatacatccggcgggaggctgaaaagcaaggcattgcgccctctcattat
gacattaatgggaatttgatttacgccagccaagagacgttaacttattttacggattta
ttgaaatcttcgtcagccacatcagaggcacaattacattttgatgatgttgtcgtgttt
cttgaaaatgaaccgattcagtatgcattaacgcgtcttcctgtggttaaccaaacgcca
ctgtcttgccaaatcatggatgaagcgggtaaacatattctgactcaatcctgtattgag
cgtgacgttatcaccttacctgcacttgagtttggttattatcatctgcggatcacttat
gaaaatcacgcttattctgtccgtttattgatcagtcctaaaacagcgtatcaaccccct
gtgttacagcaaagaaaagcatggggattgaacgttcaattatatagcttacgctcgaag
cagaattggggaattggggattttgcagacctagcgtatttagttgaacaggcgacgaag
tatggcgtggattttataggcattaatccgttgcatttgatgtatagtgcggtaccagaa
tgggcgagcccttatagctcatcttctcgtcgttggttgaaccctatttatttatctgtg
accacattgccagaatttaaatgctgtaaaagcgtgcagcattggtttgcttccgacgag
attcaagacttgcttgagcagttacaagcaacagaattagtggattatgcacaagttatg
tggttaaagcagaatgcacttgaacaattgtttgctttctcaaagcgcagtcaatcgact
tctatcattcaacgccgtcaagcctttttgcaattcatgcaacagcaaggtgaaccgtta
ttgttacaaggcttatttgaagtattagaccgtcaatcgcactcaaatatgccaacagaa
aaagagattggctggctaggttggcgtcgtgaatggcaacagttaagcccagcaaaacgc
caaacgttactcaaaacgcatcaagcagagattgagttttacgcttggttacaatggtta
gcgacagaacaattaacggatattcaagcattgtgtcatcgcctcggcatgaatttgggg
atttatggtgatttggcagttaatagttcacgcggtagtgcggatgtgtggactgatccc
gaattgtactttgtgaatgcctccgtaggggcgccgccggatcctttaggacccgttggg
caaaactggaacttacccccttataatcctgcgatcttaacccgccgtggttttcaacct
tttattgatatgttgcgcagtaatatgcagcattttgggatcttgcgtattgaccatgtg
atggggttattccgtttatggttgattcccgaagaaaaaagcgcagccgatggtgtgtat
gttcattatccctttgatgcgttaatggcgattttaacgatagaaagccaacgcaatcgt
tgcttgattgtaggggaagacttgggcactgtcccagatgaagtgcggtcaaaattaaat
cagttacacattttttcttactttgtcttatattttgagcaacgtaatcgtcaatatccc
gcaagtgaacaatttccagtgaaagcttttgctaccattggcacgcatgacgtaccgtcg
ttacaaagtttctggcactgtgttgatttacaactttttaatcaactcggcattctagac
ggtgagatcttgcaacaaaaatatgaacaacgcgtgattgataaacaagcattattggac
acgttgcatcgtgatggctatttgccccctcattatgaaggaaatgccttatcaatggcg
atgcatgctcatcttaactatgtgttacaccaatatttagccagaagttgtactcaattg
attggggtacaactggaaaatgtattaagccaagaaatttcatttaatttacccggtact
gatagggaatatccaaactggcgtaaaaagctcgcatgtacacttgaacaaatgtttagt
gataagcatatcaccgcgtttttaagcgcgattgatcaagctcgtcatgcatga

DBGET integrated database retrieval system