KEGG   Pasteurella multocida 36950: Pmu_06070Help
Entry
Pmu_06070         CDS       T01729                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmp  Pasteurella multocida 36950
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
618981..621173
Genome map
AA seq 730 aa AA seqDB search
MVQLVSPSVINQFFEGTHADPFSVLGMHETEKGIEIRALLPDASRVVVIDRETHNAVCEL
EHVDERGFFAAVIPKTRTFFAYQLQVFWGAESQFIEDPYRFHPMLADLDNWLLSEGSHLR
PYEVLGAHFMECDGVSGVNFRLWAPNAKRVSIVGDFNYWDGRRHPMRFHQKSGVWELFLP
KASLGQLYKFELIDCHGQLRLKADPYAFSSQLRPDTASQISALPEIVPMTEQRRKANQFD
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKEMGFTHIEFLPISEFPFDGSWGY
QPLGLYSPTSRFGTAEGFKRLIEKAHQAGINVILDWVPGHFPSDTHGLAAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVRNFLSSNALYWLERFGLDGIRVDAVASMIYRDYSRAEG
EWIPNQYGGRENLEAIEFLKHTNWKIDSEVQGAISIAEESTSFAGVTKPSTEGGLGFHFK
WNMGWMNDTLSYMQKDPVYRQYHHDQMTFGMVYQYSENFVLPLSHDEVVHGKCSLLGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYQESLDWFLLEEEHGGRWHQG
VQLLVKDLNHIYQQHASLFELDGSPEGFDWLVVDDRQNSVFAFERRSKDGERIIVVSNFT
PVPRHDYRFGVNMAGNYVEILNTDSAFYQGSNVGNYGEVGSEAIPSHARAQSICVSIPPL
ATIYLKYQGE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattagtttcaccttccgtgatcaatcaattttttgaaggaacgcatgcagac
ccattttctgtgttagggatgcatgaaacagagaaaggaattgaaattcgcgcattattg
ccggatgcgagccgtgtggttgtgattgacagggaaacgcataacgccgtttgcgaatta
gagcacgtcgatgaacgcggtttctttgccgcggtcataccgaaaacaagaacgtttttt
gcctatcagttacaggttttttggggcgctgaatcacaatttattgaagatccttaccgt
ttccatccgatgctggcagatttagacaattggctgttgagtgaaggatcgcatttacgt
ccttatgaagtgcttggtgcgcattttatggaatgtgatggcgtgtctggggtgaatttc
cgtttatgggcaccaaatgcaaaacgtgtttcgattgtgggcgattttaactattgggat
gggcgtcgccacccaatgcgttttcatcaaaagagcggtgtgtgggaactgtttttaccg
aaagcctcattgggtcaactgtataaatttgaattgatagactgtcatggtcagttacgc
ttaaaagcggatccttatgcctttagttcacaactgcgtcctgatacggcctcacaaatt
agcgcgttacccgaaattgtgccaatgacagaacaacgtcgtaaagcgaatcaatttgat
caacctatttcgatttatgaagtccaccttggttcgtggcgtcgcaatttagaaaataat
ttttggttggattatgatcaaattgccgatgagctcattccttatgtgaaagagatgggc
tttactcacattgaatttttaccgatttctgaatttccatttgatggttcttggggctat
caacccttggggctgtactcgccaactagtcggtttggtacggcagaaggctttaagcgt
ttaattgaaaaagcacaccaagctgggatcaatgttattttagactgggtacccggtcat
ttcccaagtgatactcacggcttagcggcatttgatggcacggcgctttatgaacatgct
gatccgcgtgaaggctaccaccaagattggaataccttaatttataactatggacgtaat
gaagtgcgtaactttttatccagcaatgcactttattggttagaacgttttggcttagat
ggtattcgggtggatgccgttgcttcgatgatttatcgtgattatagccgtgccgaagga
gagtggattccaaaccaatacggtggacgtgaaaatttagaagccattgaatttttaaaa
cacactaactggaaaattgattctgaagtacaaggcgcgatttcgattgctgaagaatcg
acatcttttgcaggcgttaccaagccgtccacagaaggggggctaggattccactttaaa
tggaatatgggctggatgaatgacaccttatcttacatgcaaaaagatccggtgtatcgt
caatatcaccacgatcaaatgacttttggtatggtgtatcaatacagcgaaaattttgtg
ttaccgctatcccacgatgaagtggtacacggtaaatgttctttactcggtaaaatgccg
ggcgatgcgtggcaaaaatttgctaacttgcgcgcttattatggttatatgtggggctat
ccgggtaaaaaattgctctttatgggcaatgaatttgcgcaagggcgcgaatggaattat
caagaaagcctcgattggtttttactggaagaagaacacggtgggcgatggcatcaaggc
gtgcaattgttagtgaaagatctcaatcatatttatcaacaacatgcctcgttatttgaa
ctcgacggctcgccagaaggatttgactggttagtggttgatgatcgtcaaaactcggtg
tttgcctttgaacgccgcagtaaagacggagagcgaattattgtcgtgagtaacttcacg
ccagtaccacgtcatgattatcgttttggcgtcaatatggcgggtaactatgtggaaatc
ttaaacacagattcggcattttatcaggggtcgaatgttggtaattacggtgaagtaggc
agtgaagcgattccaagccatgcgcgagcacaatcaatttgtgtatctattccgccactc
gccacgatttatttgaaatatcaaggggaataa

DBGET integrated database retrieval system