KEGG   Pasteurella multocida 36950: Pmu_06440Help
Entry
Pmu_06440         CDS       T01729                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmu_06440 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmu_06440 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmu_06440 (trpA)
Enzymes [BR:pmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmu_06440 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(665673..666479)
Genome map
AA seq 268 aa AA seqDB search
MRRFDTLFSQLQQKQQGAFVPFVTLCDPNLAQSFEIIQTLVENGADALELGFPFSDPMLD
GPVIQAANQRALAAGCSTDASFQLLTQVRSTYPTLPISLLLCANLVYAQGIERFYQRCAE
VGVDAVLIADLPLFAHREFTVMAEKYSIQQVFICPPNACEDTIKRVAQQTQGYTYLVSRS
GVTGVENQQSAGNLKTLVERLKAYQAPPILQGFGISQPQQVSDVLKMGVNGAISGSATVQ
IIEKYRHDPQACLAELAQFTQKMKQATT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttttgataccctcttttcacaattacaacaaaaacaacaaggtgcatttgtc
ccttttgtcacgctatgcgatcctaatctggcacagtcatttgagattattcaaacctta
gtggaaaatggtgcagacgccttagaattaggctttcctttttctgatccgatgttagat
ggtccagtgattcaagccgctaaccaacgtgcgttagccgcaggttgtagcacagatgcc
agttttcagttattaacacaagtacgatcaacttatccgacactaccaataagtttactg
ctttgtgccaatctggtttatgcacaaggcattgaacgtttttatcaacgttgtgctgaa
gtgggcgtggatgcggtattaattgcggatttaccattattcgcccatcgagagtttacg
gttatggctgaaaaatatagcattcagcaggtttttatctgtccgcctaatgcctgtgaa
gacacgatcaaacgtgtcgctcaacaaacacaaggttacacctatttagtttctcgttca
ggtgtaacaggagtagaaaatcaacaatctgctggcaacttaaaaacactcgtcgagcgc
ctcaaagcctatcaagctccccctattttgcaaggctttggtatttcgcaaccacagcaa
gttagcgatgtgttaaaaatgggcgtcaatggtgccatttcgggttctgctaccgttcaa
attattgaaaaatatcgccatgacccacaagcctgcttagctgaactagcgcagtttacg
caaaaaatgaaacaagcgaccacataa

DBGET integrated database retrieval system