KEGG   Pasteurella multocida 36950: Pmu_06450Help
Entry
Pmu_06450         CDS       T01729                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmu_06450 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmu_06450 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmu_06450 (trpB)
Enzymes [BR:pmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmu_06450 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(666466..667674)
Genome map
AA seq 402 aa AA seqDB search
MSETLLNPYFGEFGGMYVPEILMPVLKNLEKAFVEAQRDPTFKETFLDLLKNYAGRPTAL
TRCRNLTQGSKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLGMPCQIYMGAKDVERQSPNVFRMRLMGANVTAVTKGSASLKDACCEAMRDWAE
NYEHTHYLLGTAAGPHPFPTIVREFQKIIGEETKQQILAREGRLPDAIIAAVGGGSNAIG
MFNDFIEETSVRLIGVEPAGKGIATGQHGAPLGHGTTGIYFGMKAPLMQTPDGQIEESYS
ISAGLDFPSVGPQHAHLQAIGRAQYESITDDEALSAFQALARHEGIIPALESAHALAYAL
KLIQRQPEKEQLLVVNLSGRGDKDIFTVDRILSQKGVSHAPF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaccttacttaatccctatttcggcgaatttggaggaatgtatgttcccgaa
attctgatgccggtgttgaaaaatctcgaaaaagcctttgttgaggcacaacgagatccc
acatttaaagaaaccttcctcgatttattgaagaactatgcaggtcgcccaactgcgctg
actcgctgtcgcaatctcactcaaggcagtaaaaccaaactgtacctgaagcgtgaagat
ttattgcatggcggtgcacataaaaccaatcaagtattagggcaaatcttattagcgaaa
cggatggggaaaacccgtattattgcggaaacgggggcgggacaacatggcgtagcaaca
gctctcgcttgtgccatgctcggcatgccatgccaaatctacatgggcgcaaaagatgtt
gaacgtcaatcgccgaatgtatttcgtatgcgtttaatgggggcgaatgtgactgcggta
acgaaaggctcagcctcattaaaagacgcctgctgtgaagccatgcgtgattgggcagaa
aactatgaacacacccattatttactcggcacggcagcaggtcctcatccctttcctact
atcgtgcgtgagttccaaaaaatcattggtgaagaaaccaagcaacaaattctagcacgc
gaagggcgtttacctgatgcaatcattgctgcggttggtgggggttcaaatgccattggt
atgttcaatgactttatcgaggaaaccagcgtacgtttaattggtgttgaaccagcgggc
aaaggaattgccactggacaacatggcgctccgctaggtcatggcacaacaggaatctac
tttggtatgaaagcgccattaatgcaaacaccagatggacaaattgaagaatcgtattcg
atttcagcaggacttgattttccttccgttggtccacagcacgcacatttacaagcgatt
gggcgtgcccaatatgaatccattaccgatgatgaagccttatccgccttccaagcctta
gcacgccatgaaggcattattcccgcattagaaagtgctcatgccctcgcttatgcctta
aaactgattcagcgccagcctgaaaaagaacaactcttggtggtcaatttatctggacga
ggtgataaagatattttcaccgtagatcgcattttatcgcaaaaaggagtttcacatgcg
ccgttttga

DBGET integrated database retrieval system