KEGG   Pasteurella multocida 36950: Pmu_06470Help
Entry
Pmu_06470         CDS       T01729                                 

Gene name
trpC
Definition
(RefSeq) tryptophan biosynthesis protein TrpCF (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pmp  Pasteurella multocida 36950
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmu_06470 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmu_06470 (trpC)
Enzymes [BR:pmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pmu_06470 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Pmu_06470 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(668670..670079)
Genome map
AA seq 469 aa AA seqDB search
MTQALPSILQKIIQDKTTWIAEKQAQLPLASFQDQLERSDRDFYQAMQQGSKQRPSYILE
CKKASPSKGLIRAAFDLTEIAEVYQHYATVISVLTDEKYFQGHFADIAQVRQRVTQPILC
KDFILSEYQVYLARYAQADAILLMLSVLNDERYTQLATLAHQLGMGVLTETSNEAEFARA
LALKAKVIGVNNRNLHDLSVDIQRVAQITQHYADQIPPRTKIISESGIYQHQQIRDLRHV
ADGFLIGSSLMQHADLNHAVRSLLFGEHKVCGLTRPQDVRAVYQQGALYGGLIFVTHSKR
CISLRQAQELVTQAPLRFVGVFQDQSIAFICHLATQLRLHAVQLHGNESHEFIRQLRDEL
PVNCEIWRAICIESSGTSPCQIVENENIDRYIFDSKTHQQRGGTGKTFDWQLIPHHLKPK
SMLAGGITPENIPLALAQGCLGLDLNSGLETYPGVKSHQKVVAAFAQLR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgcttccctctattctgcaaaaaatcattcaagataaaaccacttggatt
gcagaaaaacaagcacaattgcctttagcaagctttcaagatcagctagaacgtagtgat
cgtgacttttatcaagcgatgcaacaaggctcaaaacaacgcccttcatatatcttagaa
tgtaaaaaagcctctccctcaaaaggcttaattcgtgcagcgttcgatttaaccgagatt
gccgaggtttatcaacactatgctacggtcatttccgtcttaaccgatgaaaaatatttt
caagggcattttgctgatattgctcaagtacgccaacgcgtgacacaaccgattttatgt
aaagattttatcttatccgaataccaagtatatttagcacgatacgcacaagctgatgcc
attttattgatgctttccgttcttaatgatgaacgctatacacaattagccacattagca
caccaattagggatgggcgttttaactgaaaccagtaatgaggcagaatttgcgcgcgca
ttagcgttaaaagcgaaagtgattggtgtcaataatcggaatttacatgatctcagtgta
gacatacaacgtgttgcccagatcactcaacactatgccgatcagattcctcctagaacc
aaaattatcagtgaatctggtatctatcaacaccaacaaattcgagacttacgccatgtt
gccgacggttttttaattggcagtagtttaatgcaacacgcagatttaaatcatgcggta
cgctcacttctttttggggaacataaagtttgtgggctcacccgtccacaagatgtaaga
gcggtttaccagcaaggtgcactttacggtggactgatttttgtgacacactcaaaacgt
tgtattagcttacgtcaagcccaagaattagtcacacaagccccattgcgctttgttggg
gtatttcaagatcaatccatagcgtttatctgtcaccttgcaactcaattaagactccac
gccgtccaattacatggcaacgaaagccacgaattcattcgccaattacgcgatgaattg
ccagtgaattgtgaaatttggcgcgccatttgcattgagagtagcggcaccagtccgtgt
caaatcgtagaaaatgaaaatattgatcgttatatttttgacagtaaaacgcatcaacaa
cgtggcggaacggggaaaacatttgattggcaattgatccctcatcacttaaaaccaaaa
agtatgttagctggtggtattacaccagaaaatatccctctggcgctcgctcaaggctgt
ttaggactggatttaaattcagggcttgaaacttatcctggtgtaaaatcacaccaaaaa
gtcgttgcagcttttgctcaactccgctaa

DBGET integrated database retrieval system