KEGG   Pasteurella multocida 36950: Pmu_07630Help
Entry
Pmu_07630         CDS       T01729                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmp  Pasteurella multocida 36950
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmu_07630 (folE)
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pmu_07630 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(801598..802254)
Genome map
AA seq 218 aa AA seqDB search
MNKISPEAEKVRNALLSKGIETPMITPEQDRDTRRAGIEQHMREVMKLIGLDLRDDSLEE
TPVRLAKMFVDEIFSGLDYANFPKITNIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGMV
SVAYYPKKWVIGLSKINRIVAFFAQRPQVQERLTEQILLAFQTILETDDVAVYVKATHFC
VKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatttcaccagaagcagaaaaagtccgcaacgcattattaagtaaggggatt
gaaaccccaatgattaccccagaacaagacagagatacgcgtcgagcggggattgaacaa
catatgcgtgaagtgatgaagctgattgggttagatttacgtgatgatagtttagaagaa
acccccgtacgtttggcgaaaatgtttgttgatgaaattttcagtgggttagactatgcg
aatttcccgaaaattactaacattgaaaatcgtatgaaagtcagtgaaatggtgttggtg
aatgacgtgacgttaaccagtacttgtgaacaccattttgtgaccattgatgggatggtt
tcggtggcgtattacccgaaaaaatgggttattgggttgtctaaaattaatcgtatcgtg
gcgttttttgcgcaacgtccacaagtacaagagcgtttgactgaacaaattttgttggca
ttccaaacgattttagaaacggacgatgtggcggtgtatgtgaaggctactcatttctgc
gtgaaatgccgtggcattaaagataccaacagttatacagtgacatctgcatttggtggt
gtctttttagatgaccgtgaaacgcgtaaagagtttttaaccttaattaataaataa

DBGET integrated database retrieval system